KEGG   Thioalkalivibrio sp. K90mix: TK90_0031Help
Entry
TK90_0031         CDS       T01174                                 

Definition
(GenBank) aspartate/ornithine carbamoyltransferase carbamoyl-P binding domain protein
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
tkm  Thioalkalivibrio sp. K90mix
Pathway
tkm00240  Pyrimidine metabolism
tkm00250  Alanine, aspartate and glutamate metabolism
tkm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tkm00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    TK90_0031
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    TK90_0031
Enzymes [BR:tkm01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     TK90_0031
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: ADC70548
UniProt: D3SBQ0
Position
35300..36382
Genome map
AA seq 360 aa AA seqDB search
MPLVNYTEDPLHVLHPKDGAAGTDRPKALLEAVEEDPDPLLKLAAAHVVSSQQFSRDELL
QLFRLAAQYETTPALMHLPLAGKILISAFYEPSTRTRLSFESAWHRLGGAVMSITDPKST
GIAKGESLADIAEMFNNYGDVLVLRSSDGEAAHNMLENLRIPLVNAGNGIDEHPTQALAD
VYTLAKWRPELFTGPVAPEDRIKVGIIGVPSRMRTVRSLLRLLSLFPEAIEEVVIISRED
ENFDPGQREELEEAGLKLRVVHELDPLLPELDVVYINAIAWVGDTFESMGEGLKLDRNSP
LKKGAVILHPLARGDELSTDLDDTPHNWYFAQARGAVFVRMALLTTVVRRISAVMDTPED
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgcctctggtgaactacaccgaagatcccctgcacgtgctccacccgaaagacggcgcc
gccggcaccgaccgcccgaaggcgctccttgaggccgtggaggaagacccggacccgctc
ctgaagctggcggccgcgcatgtggtctccagtcagcagttctcgcgcgatgaactgctg
cagctgttccgtctggcggcgcagtacgagaccactccggcgctgatgcacctgccgctg
gccggcaagattctgatcagtgcgttctacgagccgtccacgcgcacgcggctgtccttc
gagagcgcctggcaccggcttggcggggcggtgatgtcgatcaccgaccccaagagcacc
ggcatcgccaagggcgagtcgctggcggacatcgccgagatgttcaacaactacggcgac
gtgctggtgctgcgctcctcggatggcgaggcggcgcacaacatgctggagaacctgcgc
atcccgctggtcaacgcgggcaacgggatcgacgagcatccgacccaggcgctggcggac
gtctacaccctggccaagtggcgaccggagctgttcaccggcccggtggcgccggaggac
cgcatcaaggtcggtatcatcggggtgccctcgcgcatgcgcacggtgcgttcgctgctg
cgcctgctaagcctgttcccggaggcaatcgaagaggtcgtgatcatctcgcgcgaggac
gagaactttgacccgggtcagcgcgaggagttggaagaggccggcctgaagctgcgcgtg
gtgcacgaactggacccgctgctgccggagctggacgtcgtctacatcaacgccattgcc
tgggtgggggatacgttcgagtccatgggcgagggcctgaagctggatcgcaactccccg
ctcaagaagggcgcggtcatcctgcacccgctggcacgcggtgacgagctgtccacggac
ctcgacgacaccccgcacaactggtacttcgcccaggcccgcggggccgtgttcgtgcgc
atggcgctgctgaccacggtggtccgccggatcagcgcggtcatggataccccggaagac
tga

DBGET integrated database retrieval system