KEGG   Thioalkalivibrio sp. K90mix: TK90_0034Help
Entry
TK90_0034         CDS       T01174                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
tkm  Thioalkalivibrio sp. K90mix
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(39468..40769)
Genome map
AA seq 433 aa AA seqDB search
MSASEMRRTIIDLERRLEREQVQQDALRRVALRALAVVSARVPTLDGAVQDLSRAVESSP
PDSAWMDRLGAQLADAVRSSDHHEDLASAVLEVVRRGLNGFDFLDPGLDDLHRATERRDR
SEIERTLSQLFRVLHDKCERAMYERDELSDVVGEIWHRLEDVDSALSEDEKRSERTRASV
ATLHDGISDNVRAMKGRMDDLEDIATLRQEISRGLDRVVEHVAAFRNQQENDLLEALERN
RLLRAKGRTLESQVSALRKRLDQARAEAYRDSLTGLPNRTAFERYLDGLREDLGAEQPAC
LLVWDIDRFKAINDEYGHSAGDKVLKAVAEILAEGVRSEDFVARYGGEEFVMILTSDPDT
CQRRADSIREAVDRLIVRAGKTRLRVTISAGMCPIAAGQSTAAIFDAADHALLQAKKLGR
DRVERADREPHPS
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccagcgagatgcgcaggaccatcatcgacctcgagcgccgcctggagcgcgag
caggtccagcaggatgcactgaggcgggtggccctgagggcactggcggtggtcagcgcc
cgcgtgccgacactggatggcgcggttcaggacctgtcccgcgcggtggagtccagcccg
cccgactctgcctggatggatcggctgggtgcacagctggccgacgcggtccgcagctcc
gatcaccacgaggacctggccagcgctgtgctcgaggtcgtgcgccgcggactgaacggg
ttcgatttcctggaccccggcctggatgacctgcatcgcgcgaccgaacggcgcgaccgc
tcggagatcgaacgaacgctttctcagctcttccgggtgctgcacgacaagtgcgagcgc
gccatgtacgagcgcgacgagctgtcggacgtcgtgggcgagatctggcatcgcctggaa
gacgtcgactcggccctgtcggaagacgagaaacgcagcgaacgtacacgcgcctcggtt
gccaccctgcacgatggcatctcggacaatgtccgggccatgaagggccgcatggacgac
ctggaggacatcgccaccctgcgccaggagatcagccggggtctggatcgcgtggtcgaa
catgtggcggcctttcgcaatcagcaggagaacgatctgctcgaggccctggagcgcaac
cgcctcctgcgagcgaagggccgtacgctggagtcgcaggtcagtgccctgcgcaagcgg
ctggatcaggcgcgggcggaggcctaccgcgacagcctgaccgggctgcccaatcgcacg
gctttcgagcgctacctcgatggcctgcgggaggacctgggggcggagcaaccggcctgc
ctgctggtctgggacatcgaccgcttcaaggcgatcaacgacgaatacggccacagtgcc
ggcgacaaggtgctgaaggccgtcgcagagatcctggccgagggcgtgcgcagcgaggac
ttcgttgcgcgctacgggggcgaggaattcgtgatgatcctcacctccgacccggacacc
tgccagcgccgtgccgattcgatccgcgaggccgtggatcgcctgatcgtacgggccggc
aagacgcggctgcgcgtgaccatttcggcgggcatgtgcccgatcgcggccggacagtcc
accgcggccatcttcgacgccgcggatcacgccctgctacaggcgaagaagctcgggcgc
gatcgcgtggagcgggccgaccgcgagccacacccttcctga

DBGET integrated database retrieval system