KEGG   Thioalkalivibrio sp. K90mix: TK90_0054Help
Entry
TK90_0054         CDS       T01174                                 

Definition
phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
tkm  Thioalkalivibrio sp. K90mix
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tkm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TK90_0054
   01230 Biosynthesis of amino acids
    TK90_0054
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TK90_0054
   00030 Pentose phosphate pathway
    TK90_0054
   00051 Fructose and mannose metabolism
    TK90_0054
   00052 Galactose metabolism
    TK90_0054
  Energy metabolism
   00680 Methane metabolism
    TK90_0054
Enzymes [BR:tkm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     TK90_0054
Protein phosphatases and associated proteins [BR:tkm01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     TK90_0054
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
61567..62775
Genome map
AA seq 402 aa AA seqDB search
MAKVLIAQGGGPTAVINQSMVGAVLEARKFTDVELVYGAFHGVRGIIDEEFLDLTQETTH
NLEMVARTPSSALGSTRDKPDLDYCKEIFKVLKAHEITYFFYIGGNDSSDTVRIVSEEAR
KANYPMRCVHIPKTIDNDLVENDHTPGFPSAARFVAQAFVGANLDNYALPGIYLAVVMGR
HAGFLTAASALGKKFPDDGPHLIYVPERVFEVDRFLSDVKATMDRYGRCVIAVSEGIHDA
DGEPIATKLAKDVEKDAHGNVQLSGTGALADMLCGEIRDKLGVKRVRGDTFGYLQRAFIG
CVSDVDQREAREVGEKAVQFAMWQGRDGSVAIKRTGFYSVDYEYVPLEAVAGKTKVMPDE
FIDASGTDVTDAFRMYLRPLLGSGMPDAYRLRQNKVTKVLGR
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggccaaggttctgatcgcccagggtggaggcccgacggcggtaatcaatcaatccatg
gtgggcgcagtcctggaagcccggaaatttaccgacgtcgagctggtatacggggccttc
cacggggtccgcgggatcatcgacgaggagttcctggacctgacccaggagaccacccac
aatctggagatggtcgcgcggacgccctcctcggcgctgggctctacgcgtgacaagccg
gatctcgactactgcaaggagatcttcaaggtcctgaaggcccacgagatcacctacttc
ttctatatcggcggcaacgactcctccgacacggtgcgtatcgtcagcgaggaggcgcgc
aaggccaactatccgatgcgttgcgtgcatatcccgaagacgatcgacaatgacctggtg
gagaacgaccatacgccgggcttcccgtccgcagcgcgtttcgtggcccaggccttcgtc
ggcgccaacctcgacaactatgccctgccgggaatctatctggcggtggtcatgggccgc
catgccgggttcctgaccgcggcctccgccctcgggaagaaattcccggacgacgggccc
cacctgatctacgtgcccgaacgcgtattcgaagtcgaccgcttcctgtcggacgtcaag
gcgaccatggaccgttacgggcgctgcgtgatcgcggtcagcgaggggatccatgacgcg
gacggtgagccgatcgcgaccaagctcgccaaggacgtggagaaggatgcccacggtaat
gttcagctctcgggcaccggcgccctggccgacatgctctgtggcgagatccgggacaag
ctgggggtcaagcgcgtacgcggcgacaccttcggctatctgcagcgtgcctttattggc
tgtgtctcggacgtcgaccagcgcgaggcccgggaagtgggcgagaaggccgtgcagttt
gcgatgtggcagggccgcgacggctcggtcgcgatcaagcgtaccggcttttattcggtg
gactacgagtacgtgccgctggaggccgtcgctggcaagaccaaggtcatgccggacgag
ttcatcgatgcctcgggcaccgacgtcaccgacgccttccggatgtatctgcgtccgctg
ctgggctcgggcatgccggatgcctaccgcctgcgtcagaacaaggtgaccaaggtgctc
ggtcgctaa

DBGET integrated database retrieval system