KEGG   Thioalkalivibrio sp. K90mix: TK90_0054Help
Entry
TK90_0054         CDS       T01174                                 

Definition
(GenBank) phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
tkm  Thioalkalivibrio sp. K90mix
Pathway
tkm00010  Glycolysis / Gluconeogenesis
tkm00030  Pentose phosphate pathway
tkm00051  Fructose and mannose metabolism
tkm00052  Galactose metabolism
tkm00680  Methane metabolism
tkm01100  Metabolic pathways
tkm01110  Biosynthesis of secondary metabolites
tkm01120  Microbial metabolism in diverse environments
tkm01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tkm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TK90_0054
   00030 Pentose phosphate pathway
    TK90_0054
   00051 Fructose and mannose metabolism
    TK90_0054
   00052 Galactose metabolism
    TK90_0054
  Energy metabolism
   00680 Methane metabolism
    TK90_0054
Enzymes [BR:tkm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     TK90_0054
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     TK90_0054
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: ADC70571
UniProt: D3SBS3
Position
61567..62775
Genome map
AA seq 402 aa AA seqDB search
MAKVLIAQGGGPTAVINQSMVGAVLEARKFTDVELVYGAFHGVRGIIDEEFLDLTQETTH
NLEMVARTPSSALGSTRDKPDLDYCKEIFKVLKAHEITYFFYIGGNDSSDTVRIVSEEAR
KANYPMRCVHIPKTIDNDLVENDHTPGFPSAARFVAQAFVGANLDNYALPGIYLAVVMGR
HAGFLTAASALGKKFPDDGPHLIYVPERVFEVDRFLSDVKATMDRYGRCVIAVSEGIHDA
DGEPIATKLAKDVEKDAHGNVQLSGTGALADMLCGEIRDKLGVKRVRGDTFGYLQRAFIG
CVSDVDQREAREVGEKAVQFAMWQGRDGSVAIKRTGFYSVDYEYVPLEAVAGKTKVMPDE
FIDASGTDVTDAFRMYLRPLLGSGMPDAYRLRQNKVTKVLGR
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggccaaggttctgatcgcccagggtggaggcccgacggcggtaatcaatcaatccatg
gtgggcgcagtcctggaagcccggaaatttaccgacgtcgagctggtatacggggccttc
cacggggtccgcgggatcatcgacgaggagttcctggacctgacccaggagaccacccac
aatctggagatggtcgcgcggacgccctcctcggcgctgggctctacgcgtgacaagccg
gatctcgactactgcaaggagatcttcaaggtcctgaaggcccacgagatcacctacttc
ttctatatcggcggcaacgactcctccgacacggtgcgtatcgtcagcgaggaggcgcgc
aaggccaactatccgatgcgttgcgtgcatatcccgaagacgatcgacaatgacctggtg
gagaacgaccatacgccgggcttcccgtccgcagcgcgtttcgtggcccaggccttcgtc
ggcgccaacctcgacaactatgccctgccgggaatctatctggcggtggtcatgggccgc
catgccgggttcctgaccgcggcctccgccctcgggaagaaattcccggacgacgggccc
cacctgatctacgtgcccgaacgcgtattcgaagtcgaccgcttcctgtcggacgtcaag
gcgaccatggaccgttacgggcgctgcgtgatcgcggtcagcgaggggatccatgacgcg
gacggtgagccgatcgcgaccaagctcgccaaggacgtggagaaggatgcccacggtaat
gttcagctctcgggcaccggcgccctggccgacatgctctgtggcgagatccgggacaag
ctgggggtcaagcgcgtacgcggcgacaccttcggctatctgcagcgtgcctttattggc
tgtgtctcggacgtcgaccagcgcgaggcccgggaagtgggcgagaaggccgtgcagttt
gcgatgtggcagggccgcgacggctcggtcgcgatcaagcgtaccggcttttattcggtg
gactacgagtacgtgccgctggaggccgtcgctggcaagaccaaggtcatgccggacgag
ttcatcgatgcctcgggcaccgacgtcaccgacgccttccggatgtatctgcgtccgctg
ctgggctcgggcatgccggatgcctaccgcctgcgtcagaacaaggtgaccaaggtgctc
ggtcgctaa

DBGET integrated database retrieval system