KEGG   Thioalkalivibrio sp. K90mix: TK90_0085Help
Entry
TK90_0085         CDS       T01174                                 

Definition
phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
tkm  Thioalkalivibrio sp. K90mix
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:tkm01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:tkm01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:tkm00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:tkm00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:tkm00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:tkm00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:tkm00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
94674..95939
Genome map
AA seq 421 aa AA seqDB search
MPQNALYAQSGGVTAVINASAWGVIEAVRAHPAHFGKIYAARDGILGVLREEIIDLDHED
PLTLAALRHTPGGAFGSCRFDLGDPDKDPEQYERLVEVFRAHDIGTFFYNGGGGSMDTAL
KIAKMGERMGFPIRAIGVPKTIDNDLAVTDSSPGFGSAAKFIATVVREASLDVESMHTSS
TKVFVMEVMGRHAGWLAAAAALAQEFDGQPPMLILFAEVPFDQNDFLDHLNRTIERHGYC
VVVVSEGLKNPDGGLFSVAQSHDVYAYTQLGGAAPRLAELIREKTGHKLHWAVVDYIQRA
ARHIASKVDVEQAYACGRAAVEGVVAGEDAFMPIIRRDSNKPYRWSIGFTHLETVADIEQ
GMPRNYITPDGYGITQAARDYLRPLIQGEDAPPFEQGLPCYPRIRGELLPKRCTPFEVRS
D
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgccgcagaacgcgctgtacgcccagtcgggcggggtcaccgccgtcatcaacgccagt
gcctggggggtgatcgaggcggtccgcgcccacccggcccatttcggcaagatctatgcg
gcgcgggatggcatcctgggtgtcctgcgtgaagagatcatcgacctcgaccacgaggat
ccgctgaccctggccgccctgcgccatacgcccgggggtgcgttcggctcctgtcgcttc
gacctgggtgaccccgacaaggacccggagcagtacgagcgtctggtcgaggtcttccgc
gcccatgacatcggcaccttcttctacaacggcggtggcggctccatggataccgcgctg
aagatcgcgaagatgggtgagcgcatgggctttccgatcagggcgatcggcgtgcccaag
acgatcgacaacgaccttgccgtgaccgactcgagcccgggctttggttccgccgccaag
ttcatcgccaccgtggtgcgcgaggccagtctggatgtcgagtccatgcataccagctcc
accaaggtgttcgtgatggaggtgatgggtcgccatgccggctggctggcggccgccgcg
gcgctggcgcaggagttcgacggccagccgcccatgctgatcctgttcgccgaggtcccg
ttcgaccagaacgacttcctggaccacctgaaccgcaccatcgagcgtcacgggtattgt
gtggtggttgtctccgaggggctgaagaatcccgacggcggcctgttctcggtcgcccag
agccacgacgtctacgcctacacccagctcggcggcgccgccccgcgcctggccgaactg
atccgcgagaagaccgggcacaagctgcactgggcggtggtggactacatccagcgtgcc
gcgcgccatatcgcgtcgaaggtggacgtggagcaggcttatgcctgcggccgcgcggcg
gtggagggtgtggtcgcgggggaggacgctttcatgccgattatccggcgcgactccaac
aagccctatcgctggagtatcgggttcacccatctcgagactgtcgccgacatcgagcag
ggcatgccgcgcaactacatcaccccggacggctacggcatcacccaggctgcccgtgac
tacctgcgcccgctgatccagggcgaggacgcccccccattcgagcagggcctgccctgc
tacccgcgcattcgtggcgaactgcttcccaaacggtgcacaccgttcgaggtcaggagc
gactag

DBGET integrated database retrieval system