KEGG   Thioalkalivibrio sp. K90mix: TK90_0085Help
Entry
TK90_0085         CDS       T01174                                 

Definition
phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
tkm  Thioalkalivibrio sp. K90mix
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tkm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TK90_0085
   01230 Biosynthesis of amino acids
    TK90_0085
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TK90_0085
   00030 Pentose phosphate pathway
    TK90_0085
   00051 Fructose and mannose metabolism
    TK90_0085
   00052 Galactose metabolism
    TK90_0085
  Energy metabolism
   00680 Methane metabolism
    TK90_0085
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    TK90_0085
Enzymes [BR:tkm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     TK90_0085
Protein phosphatases and associated proteins [BR:tkm01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     TK90_0085
Messenger RNA biogenesis [BR:tkm03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     TK90_0085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
94674..95939
Genome map
AA seq 421 aa AA seqDB search
MPQNALYAQSGGVTAVINASAWGVIEAVRAHPAHFGKIYAARDGILGVLREEIIDLDHED
PLTLAALRHTPGGAFGSCRFDLGDPDKDPEQYERLVEVFRAHDIGTFFYNGGGGSMDTAL
KIAKMGERMGFPIRAIGVPKTIDNDLAVTDSSPGFGSAAKFIATVVREASLDVESMHTSS
TKVFVMEVMGRHAGWLAAAAALAQEFDGQPPMLILFAEVPFDQNDFLDHLNRTIERHGYC
VVVVSEGLKNPDGGLFSVAQSHDVYAYTQLGGAAPRLAELIREKTGHKLHWAVVDYIQRA
ARHIASKVDVEQAYACGRAAVEGVVAGEDAFMPIIRRDSNKPYRWSIGFTHLETVADIEQ
GMPRNYITPDGYGITQAARDYLRPLIQGEDAPPFEQGLPCYPRIRGELLPKRCTPFEVRS
D
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgccgcagaacgcgctgtacgcccagtcgggcggggtcaccgccgtcatcaacgccagt
gcctggggggtgatcgaggcggtccgcgcccacccggcccatttcggcaagatctatgcg
gcgcgggatggcatcctgggtgtcctgcgtgaagagatcatcgacctcgaccacgaggat
ccgctgaccctggccgccctgcgccatacgcccgggggtgcgttcggctcctgtcgcttc
gacctgggtgaccccgacaaggacccggagcagtacgagcgtctggtcgaggtcttccgc
gcccatgacatcggcaccttcttctacaacggcggtggcggctccatggataccgcgctg
aagatcgcgaagatgggtgagcgcatgggctttccgatcagggcgatcggcgtgcccaag
acgatcgacaacgaccttgccgtgaccgactcgagcccgggctttggttccgccgccaag
ttcatcgccaccgtggtgcgcgaggccagtctggatgtcgagtccatgcataccagctcc
accaaggtgttcgtgatggaggtgatgggtcgccatgccggctggctggcggccgccgcg
gcgctggcgcaggagttcgacggccagccgcccatgctgatcctgttcgccgaggtcccg
ttcgaccagaacgacttcctggaccacctgaaccgcaccatcgagcgtcacgggtattgt
gtggtggttgtctccgaggggctgaagaatcccgacggcggcctgttctcggtcgcccag
agccacgacgtctacgcctacacccagctcggcggcgccgccccgcgcctggccgaactg
atccgcgagaagaccgggcacaagctgcactgggcggtggtggactacatccagcgtgcc
gcgcgccatatcgcgtcgaaggtggacgtggagcaggcttatgcctgcggccgcgcggcg
gtggagggtgtggtcgcgggggaggacgctttcatgccgattatccggcgcgactccaac
aagccctatcgctggagtatcgggttcacccatctcgagactgtcgccgacatcgagcag
ggcatgccgcgcaactacatcaccccggacggctacggcatcacccaggctgcccgtgac
tacctgcgcccgctgatccagggcgaggacgcccccccattcgagcagggcctgccctgc
tacccgcgcattcgtggcgaactgcttcccaaacggtgcacaccgttcgaggtcaggagc
gactag

DBGET integrated database retrieval system