KEGG   Thioalkalivibrio sp. K90mix: TK90_0085Help
Entry
TK90_0085         CDS       T01174                                 

Definition
(GenBank) phosphofructokinase
  KO
K21071  
ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
tkm  Thioalkalivibrio sp. K90mix
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tkm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TK90_0085
   00030 Pentose phosphate pathway
    TK90_0085
   00051 Fructose and mannose metabolism
    TK90_0085
   00052 Galactose metabolism
    TK90_0085
  Energy metabolism
   00680 Methane metabolism
    TK90_0085
Enzymes [BR:tkm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     TK90_0085
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     TK90_0085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
94674..95939
Genome map
AA seq 421 aa AA seqDB search
MPQNALYAQSGGVTAVINASAWGVIEAVRAHPAHFGKIYAARDGILGVLREEIIDLDHED
PLTLAALRHTPGGAFGSCRFDLGDPDKDPEQYERLVEVFRAHDIGTFFYNGGGGSMDTAL
KIAKMGERMGFPIRAIGVPKTIDNDLAVTDSSPGFGSAAKFIATVVREASLDVESMHTSS
TKVFVMEVMGRHAGWLAAAAALAQEFDGQPPMLILFAEVPFDQNDFLDHLNRTIERHGYC
VVVVSEGLKNPDGGLFSVAQSHDVYAYTQLGGAAPRLAELIREKTGHKLHWAVVDYIQRA
ARHIASKVDVEQAYACGRAAVEGVVAGEDAFMPIIRRDSNKPYRWSIGFTHLETVADIEQ
GMPRNYITPDGYGITQAARDYLRPLIQGEDAPPFEQGLPCYPRIRGELLPKRCTPFEVRS
D
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgccgcagaacgcgctgtacgcccagtcgggcggggtcaccgccgtcatcaacgccagt
gcctggggggtgatcgaggcggtccgcgcccacccggcccatttcggcaagatctatgcg
gcgcgggatggcatcctgggtgtcctgcgtgaagagatcatcgacctcgaccacgaggat
ccgctgaccctggccgccctgcgccatacgcccgggggtgcgttcggctcctgtcgcttc
gacctgggtgaccccgacaaggacccggagcagtacgagcgtctggtcgaggtcttccgc
gcccatgacatcggcaccttcttctacaacggcggtggcggctccatggataccgcgctg
aagatcgcgaagatgggtgagcgcatgggctttccgatcagggcgatcggcgtgcccaag
acgatcgacaacgaccttgccgtgaccgactcgagcccgggctttggttccgccgccaag
ttcatcgccaccgtggtgcgcgaggccagtctggatgtcgagtccatgcataccagctcc
accaaggtgttcgtgatggaggtgatgggtcgccatgccggctggctggcggccgccgcg
gcgctggcgcaggagttcgacggccagccgcccatgctgatcctgttcgccgaggtcccg
ttcgaccagaacgacttcctggaccacctgaaccgcaccatcgagcgtcacgggtattgt
gtggtggttgtctccgaggggctgaagaatcccgacggcggcctgttctcggtcgcccag
agccacgacgtctacgcctacacccagctcggcggcgccgccccgcgcctggccgaactg
atccgcgagaagaccgggcacaagctgcactgggcggtggtggactacatccagcgtgcc
gcgcgccatatcgcgtcgaaggtggacgtggagcaggcttatgcctgcggccgcgcggcg
gtggagggtgtggtcgcgggggaggacgctttcatgccgattatccggcgcgactccaac
aagccctatcgctggagtatcgggttcacccatctcgagactgtcgccgacatcgagcag
ggcatgccgcgcaactacatcaccccggacggctacggcatcacccaggctgcccgtgac
tacctgcgcccgctgatccagggcgaggacgcccccccattcgagcagggcctgccctgc
tacccgcgcattcgtggcgaactgcttcccaaacggtgcacaccgttcgaggtcaggagc
gactag

DBGET integrated database retrieval system