KEGG   Thioalkalivibrio sp. K90mix: TK90_0672Help
Entry
TK90_0672         CDS       T01174                                 

Definition
uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
tkm  Thioalkalivibrio sp. K90mix
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:tkm00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
715742..716596
Genome map
AA seq 284 aa AA seqDB search
MSGPAIRARAVSGELAGCRVALPESRALEVFAGLLERRGAEVWRCPLIAIHDSPDRVAIE
TWLDKAIAAPFDCLIFLTGEGFTRLTGFAQRAGCEDDWLAAVRRTPTLVRGPKPGRVMKP
FGVRPDAVAVAPTTEGIIETLSGQDLAGRRIGLQLYGAEPNRRLLGFLEQAGAEDFPVWP
YRYADAAEAGRVTGLIEAMIAGDVDAIAFTSQAQVRRLLRVARDSGYQDSLLAALGRTVV
AAIGPVVADELRAHGVHPTVVPDSQYFMKPLVSALARHLDAHGR
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
gtgagcggaccggcgatccgtgcgcgtgcggtctccggcgagcttgccggctgccgggtc
gcgctcccggagagccgggcgctggaggtcttcgccggcctgctggagcggcgcggggcc
gaggtctggcgctgcccgctgatcgcgatccacgacagccccgaccgcgtggcgatcgag
acctggctggacaaggccatcgcggcgccgttcgattgcctgatcttcctgaccggcgag
ggcttcacccgcctgaccggctttgcgcagcgtgccggatgcgaggacgactggctggcg
gccgtgaggcggacgccgaccctggtgcgcggccccaagccggggcgggtgatgaagccc
ttcggcgtgcggccggatgcggtcgcggtggccccgacgaccgagggcattatcgaaacc
ctttctggacaggatctggccgggcggcgtatcgggctacagctctacggcgcggagccc
aaccggcgcctgctcgggtttctggagcaggccggtgccgaggactttcccgtctggccc
tatcgctatgcggatgccgccgaggccgggcgagtgactggattgatcgaggccatgatc
gcgggggatgtggatgcgatcgccttcaccagccaggcccaggtgcggcgcctgctgcgc
gttgcccgtgactcggggtatcaggattcgctgctggcggcgctcggccgcaccgtcgtc
gccgcgatcggcccggtggtggccgacgagctgcgcgcccacggggtgcatccgacggtg
gtccccgacagtcagtacttcatgaaacccctggtctcggcgctcgcgcgccacctggat
gcacatggccgctga

DBGET integrated database retrieval system