KEGG   Thioalkalivibrio sp. K90mix: TK90_0704Help
Entry
TK90_0704         CDS       T01174                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
tkm  Thioalkalivibrio sp. K90mix
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tkm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    TK90_0704
Enzymes [BR:tkm01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     TK90_0704
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
756751..757644
Genome map
AA seq 297 aa AA seqDB search
MGMDTEGATAVLRCGRHRLALDRPRIMGILNVTPDSFSDGGSHQRVEQALEHARRMVEQG
ADLIDIGGESTRPGAEPVALEEERRRVLPVIEALAAELEVPLSVDTMKPELMREAVAAGA
TLLNDVNGFRAEGAWEAAVTAAREQGVALCAMHMQGEPQSMQQAPHYDDVAREVGAFLRD
RREAFAREGVPAEQLLLDPGFGFGKTLEHNLALFHALPALADLGSPLLVGVSRKSMIGAL
LGDRPVQERDTGSAIAALLAAQAGARVLRVHDVAGTHDALALYFALTLQAWRGSRQP
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgggcatggatacggaaggcgcgactgcggtcctgcgctgcggaaggcaccggctggcg
ctggatcgcccccgaatcatgggcatcctgaatgtcacgcccgattcgttctccgacggt
ggctcgcatcagcgtgtggaacaggccctggagcacgcccgcaggatggtggagcagggc
gccgacctgatcgatatcgggggcgagtcgacgcgtccgggggctgagccagtcgcactg
gaggaggaacggcggcgggtgttgcccgtgatcgaggcccttgccgcggaactggaggtc
ccgctgtcggtggacacgatgaagcctgagctgatgcgcgaggccgtggcggcgggggcc
acgctgctgaatgacgtcaacgggtttcgcgccgagggggcctgggaagccgccgttact
gccgcccgcgagcagggtgtggccctgtgcgcgatgcacatgcagggggagccgcagtcc
atgcagcaggccccgcactacgacgacgtcgcacgggaggtgggcgcgttcctgcgtgat
cggcgcgaggcgtttgcgcgcgaaggcgtgccagccgagcagttgctgctggacccgggc
ttcggatttggcaagacgctggagcacaacctggcacttttccatgcgctgcccgcgctg
gccgatttggggtcgccgctgctggtgggggtctcgcgcaagtcgatgatcggtgccctg
ctgggggatcgtccggtccaggaacgtgacaccggttccgcgattgcggcgttactggcg
gcgcaggccggcgcgcgtgtcctgcgtgtgcacgatgtcgcagggacacacgatgcgctg
gcgctatactttgcactgacactacaggcatggcggggctcccgccagccgtga

DBGET integrated database retrieval system