KEGG   Thioalkalivibrio sp. K90mix: TK90_0706Help
Entry
TK90_0706         CDS       T01174                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tkm  Thioalkalivibrio sp. K90mix
Pathway
tkm00010  Glycolysis / Gluconeogenesis
tkm00051  Fructose and mannose metabolism
tkm00562  Inositol phosphate metabolism
tkm00710  Carbon fixation in photosynthetic organisms
tkm01100  Metabolic pathways
tkm01110  Biosynthesis of secondary metabolites
tkm01120  Microbial metabolism in diverse environments
tkm01130  Biosynthesis of antibiotics
tkm01200  Carbon metabolism
tkm01230  Biosynthesis of amino acids
Module
tkm_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:tkm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TK90_0706
   00051 Fructose and mannose metabolism
    TK90_0706
   00562 Inositol phosphate metabolism
    TK90_0706
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    TK90_0706
Enzymes [BR:tkm01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     TK90_0706
Exosome [BR:tkm04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   TK90_0706
  Exosomal proteins of bladder cancer cells
   TK90_0706
  Exosomal proteins of melanoma cells
   TK90_0706
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADC71221
UniProt: D3SFJ1
Position
759202..759969
Genome map
AA seq 255 aa AA seqDB search
MRKPLVAGNWKMNGSREANRALLSALKDSLGDLQDVDVAVCPPAVYLSEIAETLSGSVIE
VGAQDCSDQEKGAYTGELAGSMLAEAGCRYVIVGHSERRERQNESSEWVAAKFIAAQAAG
LTPILCVGEQKSDREGGRTESVVAEQLDAVLDAAGVEAFDRAVIAYEPVWAIGTGLTATP
EQAQEVHAFIRNRVAGRDPRIAADLRVLYGGSMKADNAAGLLALEDIDGGLIGGASLDAD
AFAAIARAAAERVAA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaagccgctggtcgccggtaactggaagatgaacggttcgcgcgaggcgaaccgc
gccctcctgtcggccctgaaggacagtctgggcgacctgcaggatgtcgacgttgcggtg
tgtccgcccgccgtctacctgtccgagatcgccgagaccctgtcgggcagcgtgatcgag
gtcggtgcgcaggactgctcggatcaggaaaagggcgcctataccggtgaattggccggt
tccatgctggccgaggcgggctgtcgttacgtgatcgttggccactccgagcgccgcgag
cgccagaacgagtccagcgagtgggtggcagccaagttcatcgccgcccaggccgccggg
ctgacgccgatcctgtgtgtcggcgagcagaagagtgaccgcgaaggcggacgcaccgaa
tccgtggtggccgagcagctggatgcggtactggatgccgccggcgtcgaggccttcgat
cgcgccgtgattgcctacgagcccgtctgggcgatcggcaccggtctgaccgccacgccc
gagcaggcgcaggaagtgcatgcctttatccgcaaccgggtggcgggtcgtgatccgcgc
atcgctgcggatctgcgcgtcctctacggcggcagcatgaaggcggacaacgccgcgggc
ctgctggcgctggaagacatcgacggcgggctgatcggtggcgcctcgctggacgccgat
gcctttgccgcgatcgcccgtgcggcggccgagcgggtcgcggcatga

DBGET integrated database retrieval system