KEGG   Thioalkalivibrio sp. K90mix: TK90_0706Help
Entry
TK90_0706         CDS       T01174                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tkm  Thioalkalivibrio sp. K90mix
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:tkm01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:tkm01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:tkm00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:tkm00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:tkm00562]
Metabolism; Energy metabolism; Carbon fixation in photosynthetic organisms [PATH:tkm00710]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
759202..759969
Genome map
AA seq 255 aa AA seqDB search
MRKPLVAGNWKMNGSREANRALLSALKDSLGDLQDVDVAVCPPAVYLSEIAETLSGSVIE
VGAQDCSDQEKGAYTGELAGSMLAEAGCRYVIVGHSERRERQNESSEWVAAKFIAAQAAG
LTPILCVGEQKSDREGGRTESVVAEQLDAVLDAAGVEAFDRAVIAYEPVWAIGTGLTATP
EQAQEVHAFIRNRVAGRDPRIAADLRVLYGGSMKADNAAGLLALEDIDGGLIGGASLDAD
AFAAIARAAAERVAA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaagccgctggtcgccggtaactggaagatgaacggttcgcgcgaggcgaaccgc
gccctcctgtcggccctgaaggacagtctgggcgacctgcaggatgtcgacgttgcggtg
tgtccgcccgccgtctacctgtccgagatcgccgagaccctgtcgggcagcgtgatcgag
gtcggtgcgcaggactgctcggatcaggaaaagggcgcctataccggtgaattggccggt
tccatgctggccgaggcgggctgtcgttacgtgatcgttggccactccgagcgccgcgag
cgccagaacgagtccagcgagtgggtggcagccaagttcatcgccgcccaggccgccggg
ctgacgccgatcctgtgtgtcggcgagcagaagagtgaccgcgaaggcggacgcaccgaa
tccgtggtggccgagcagctggatgcggtactggatgccgccggcgtcgaggccttcgat
cgcgccgtgattgcctacgagcccgtctgggcgatcggcaccggtctgaccgccacgccc
gagcaggcgcaggaagtgcatgcctttatccgcaaccgggtggcgggtcgtgatccgcgc
atcgctgcggatctgcgcgtcctctacggcggcagcatgaaggcggacaacgccgcgggc
ctgctggcgctggaagacatcgacggcgggctgatcggtggcgcctcgctggacgccgat
gcctttgccgcgatcgcccgtgcggcggccgagcgggtcgcggcatga

DBGET integrated database retrieval system