KEGG   Thioalkalivibrio sp. K90mix: TK90_0812Help
Entry
TK90_0812         CDS       T01174                                 

Definition
cytochrome-c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
tkm  Thioalkalivibrio sp. K90mix
Brite
Enzymes [BR:tkm01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     TK90_0812
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
868442..869446
Genome map
AA seq 334 aa AA seqDB search
MKTLSGFRMTALAACAALAFGAAAPAAADTDYSEYRDVFEPLPALPPIPADNSMTKEKIE
LGKMLFFEPRISSSGVISCATCHNPALGWADRIPRAVGHDGQVGERNTPTVLNSGFFTAQ
FWDGREDDLEGQALGPIQDAIEMAMPLEEAIARLEEFNEYQEKFEAAYPDYDGDNVINTD
HVAKALATFQRTLNTPNSPLDRWLAGDEGAMSEQQMRGMKLFADNGCVACHSGPALTDSN
FHRIQVPGSEDKGRYLVTGDEADKFAFKTPTLRNVALTYPYMNNGETATLDEAIRIMGQE
MLGMEFSDDEVADIEAFMHALTGEMPRFDIPALP
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgctttccggattccgcatgacggcgctggccgcctgtgcggccctggcgttc
ggggcggcggccccggccgcggccgatactgactattccgagtaccgcgacgtattcgag
ccgctgccggcgctgccgccgatcccggcggataactcgatgaccaaggagaagatcgag
ctgggcaagatgctcttcttcgagccgcgcatctccagctccggcgtgatctcctgcgcg
acctgccataacccggcgctgggctgggcggaccgcatcccgcgcgcggtgggccacgac
ggccaggtgggcgaacgcaataccccgaccgtgctgaattccggcttcttcaccgcccag
ttctgggatggtcgcgaggacgatctggagggtcaggccctcggtccgatccaggatgcg
atcgagatggcgatgccgctggaggaggcgatcgcgcgcctggaggagttcaacgagtac
caggagaagttcgaggcggcctatcccgactatgacggcgacaacgtgatcaacaccgac
cacgtggcgaaggcgctggcgaccttccagcgcacgctgaacaccccgaactcgccgctg
gatcgctggctggccggggacgagggcgcgatgagcgagcagcagatgcgcggaatgaag
ctgttcgccgacaacggttgtgtggcttgccacagcggcccggcattgaccgacagcaac
ttccaccgcatccaggtgccgggctcggaggacaagggtcgctatctggtcacgggcgac
gaggccgacaagttcgccttcaagaccccgaccctgcgcaacgtcgcgctgacctacccc
tacatgaacaacggcgagaccgccacgctggacgaagcgatccgcatcatggggcaggag
atgctgggcatggagttcagcgatgacgaggtcgcggacatcgaggccttcatgcatgca
ctgaccggcgaaatgccgcgcttcgacatccctgcgctgccgtaa

DBGET integrated database retrieval system