KEGG   Thioalkalivibrio sp. K90mix: TK90_1068Help
Entry
TK90_1068         CDS       T01174                                 

Definition
Arylesterase (EC:3.1.1.2)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
tkm  Thioalkalivibrio sp. K90mix
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:tkm01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1128828..1129595
Genome map
AA seq 255 aa AA seqDB search
MWRYSLVIIAWLALLWSPLGLANSISSENSGEEPAKVLVFGDSLSAAFGMSDAESWVGLL
EERLSERNHPWHVANASISGETTAGGRERLPEVLERESPDLVILALGGNDGLRGLSPRAM
RENLEAMLEAIDAAGAQTLLLGIRIPPNYGPQYSQRFEAVFADLARERGLVFEPFFLHEV
AFRDGMIMDDGIHPTPEAQPYMLDAVWPHLEPMMRGIEACLDDAVSVSERPSQIRQDVLW
EELAQHRMDVAFDLG
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgttattccctggtcattattgcgtggctcgcgttgctatggagtccgcttggc
cttgcgaattccatcagctcggaaaattcgggggaagaacccgcgaaggtgctggtgttc
ggtgattccctgagcgcggcattcgggatgagcgatgcggaaagctgggtggggcttctg
gaagagcgtctgagtgagcgcaatcatccctggcacgtggcgaatgcctcgatcagtggc
gaaacgacggccggggggcgcgaacgcctgccggaggtcctcgaacgcgagagccccgac
cttgtgatcctggccctggggggcaacgacggcctgcgcggactctcgccacgggccatg
cgcgagaacctggaggcgatgctggaggcgatcgacgcggcgggcgcccagaccctgctg
ctcgggatccgcattccgcccaactacggcccccagtacagtcagcggttcgaggccgtc
ttcgccgatctggcgcgggaacgcgggctggtgttcgagccgttcttcctgcacgaggtc
gcctttcgcgacgggatgatcatggatgacgggatccatccgacgcccgaggcgcagccc
tacatgctggatgcggtatggccccacctggagcccatgatgcgcgggatagaagcctgt
ctggacgatgccgtttcagtttccgagcgcccgtcgcagatccgtcaagacgtcctctgg
gaggagctggcgcagcaccggatggatgtcgcgttcgacctcggatag

DBGET integrated database retrieval system