KEGG   Thioalkalivibrio sp. K90mix: TK90_1093Help
Entry
TK90_1093         CDS       T01174                                 

Definition
(GenBank) Phosphomannomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
tkm  Thioalkalivibrio sp. K90mix
Pathway
tkm00010  Glycolysis / Gluconeogenesis
tkm00030  Pentose phosphate pathway
tkm00051  Fructose and mannose metabolism
tkm00052  Galactose metabolism
tkm00230  Purine metabolism
tkm00500  Starch and sucrose metabolism
tkm00520  Amino sugar and nucleotide sugar metabolism
tkm00521  Streptomycin biosynthesis
tkm01100  Metabolic pathways
tkm01110  Biosynthesis of secondary metabolites
tkm01120  Microbial metabolism in diverse environments
tkm01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tkm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TK90_1093
   00030 Pentose phosphate pathway
    TK90_1093
   00051 Fructose and mannose metabolism
    TK90_1093
   00052 Galactose metabolism
    TK90_1093
   00500 Starch and sucrose metabolism
    TK90_1093
   00520 Amino sugar and nucleotide sugar metabolism
    TK90_1093
  Nucleotide metabolism
   00230 Purine metabolism
    TK90_1093
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    TK90_1093
Enzymes [BR:tkm01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     TK90_1093
    5.4.2.8  phosphomannomutase
     TK90_1093
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_III PGM_PMM_II PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: ADC71605
UniProt: D3S9A0
Position
1156533..1157879
Genome map
AA seq 448 aa AA seqDB search
MKIDCFKAYDVRGRVPDQLNPEVVYAIGRAFAEEVRPGRTVVGHDIRLSSPALAQALTEG
LTAGGSDVADIGLCGTEEVYFATAHYGAGGGVMVTASHNPLDYNGLKLVRSEARPISGDS
GLQAIRACAERGDFRPMPQGQVHPLDHRPDYIARLLASVDREALPKLRVVVNPGNGGAGP
VLEALEPHLPFELIHVNFEPDGHFPNGIPNPLLPQNRAATADAVRRHGADLGVAWDGDFD
RCFFFDAAGNFIEGYYIVGLLAQACLEAGQPGERIVHDPRLTWNTIEMVRAAGGEPIQSK
TGHAFMKERLRHEDAIYGGEMSAHHYFRDFYYCDSGMLPWLRVAELMGRRGQPLGDMVAE
RMARYPCSGELNFEVADVAMATDRVLKAFAGQGGVEDRTDGVSLEFSDWRFNLRSSNTEP
LLRLNVETRADPALLERRVEELSRLIRG
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcgattgtttcaaggcgtatgacgtacgcggccgcgtgccggatcaactcaac
cccgaggtggtatacgccatcggacgcgcctttgccgaagaggtccgtcctggccgcacg
gtagtggggcacgatatccgcctgtccagcccggcactggcccaggccctgaccgaagga
ctgaccgctggcggcagcgatgtggccgacatcggcctgtgcgggaccgaagaggtctac
tttgcgactgcgcactacggggccggcggcggggtgatggttaccgccagccacaatccg
ctggattacaacggactcaagctcgtgcgcagcgaggcacgtccgatcagtggcgactcc
gggctgcaggcgatccgggcatgcgcggagcgcggcgacttccgccccatgccgcagggc
caggtgcatccgctggaccaccggccggactacattgccagactgctcgcatcggtcgac
cgcgaggccctgccgaagctgcgcgtagtcgtgaacccgggcaatggtggtgcgggcccg
gtgctggaggcactggaaccgcatctgccgttcgagctgatccacgtgaatttcgagccg
gacggacatttccccaatggcatccccaacccgctgttgccgcagaaccgcgcggcgacg
gcggatgccgtgcgccggcatggggcggatctgggggtggcctgggatggcgatttcgac
cgctgcttcttcttcgatgcggcggggaatttcatcgagggttactacatcgtggggctt
ctggcgcaggcctgtctggaagccggacaacccggcgagcggatcgtccacgatccacgc
ctgacctggaacaccatcgagatggtgcgagccgcgggtggcgagccgatacagtcgaaa
accgggcatgcgttcatgaaggagcggctgcgtcatgaggatgccatctacggcggcgag
atgagtgcccaccactacttccgcgacttctactactgcgacagcgggatgctgccctgg
ctgcgagtggccgaactgatggggcggcgtggccagccgctgggcgacatggtggcggag
cgcatggcccgctacccctgcagcggcgagctgaacttcgaggtcgcggatgttgcgatg
gccaccgaccgcgtactgaaggcctttgccgggcagggcggggtggaggatcggaccgat
ggggtcagcctcgaattctcggactggcgctttaacctgcgcagctccaataccgagccg
ctgctgcggctgaacgtcgagacccgtgccgatccagccctgctggagcgccgcgtggaa
gagctttcccgcctgatacggggataa

DBGET integrated database retrieval system