KEGG   Thioalkalivibrio sp. K90mix: TK90_1179Help
Entry
TK90_1179         CDS       T01174                                 

Definition
response regulator receiver modulated CheB methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
tkm  Thioalkalivibrio sp. K90mix
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:tkm02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:tkm02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1254926..1256032
Genome map
AA seq 368 aa AA seqDB search
MPVKVLVVDDSGFFRRRISEILDADAGIEVVGSAENGEEAIRKVKELDPDVVTMDIEMPV
MDGITAVRRIMAENPRPVLMFSSLTTEGAQATLDALEAGAVDFLPKRFSDIASDEDSARM
MLRRRVRSLSRSRARSVSQPGSARPAVEARPSARREESDRKAAEVQRQAPPVSRPAVPLR
QVRAVLIGTSTGGPVALQEVLKALPANFPQPILLIQHMPASFTPAFAERLDAMCQIRVKQ
AQDGDVMRPGVALLAPGGMQTTLERGSQTTVRVTESPLGTIYKPSVDAAFSSAVEALRGQ
VLAVVLTGMGADGREGARALKGAGAQVWAQDAATSVVYGMPAAVAEAGLVDHVYPLPDVG
PALVKGFC
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgccggtaaaggtactggtggtggatgactccgggtttttccgccgccgcatcagtgaa
attctggacgccgacgcggggatcgaggtcgtcggcagcgcggagaacggcgaggaggcg
attcgcaaggtcaaggaactggacccggatgtcgtgaccatggacatcgagatgcccgta
atggacggtatcaccgcggtgcgccggatcatggccgagaaccctcggccggtactgatg
ttctcgagtctcaccaccgagggagcccaggcgaccctggatgcgctggaggcgggggca
gtcgattttctgccgaaacgcttcagtgacatcgcatccgacgaggacagcgcacgtatg
atgctgcgccggcgggtgcgcagcctttcgcgcagccgggcccgttcggtcagccagccg
gggagcgcacgtccagcggtcgaggcccgcccctctgcgcgtcgtgaagagtccgatcgc
aaggcggccgaagtacagcgacaggcaccgccggtcagtcggcccgccgtgccgctgcgg
caggtccgcgcggtgctgattgggacgtccaccggaggcccggtggccttgcaggaggtg
ctcaaggccctgccggcgaatttcccgcagccgattctgctgattcaacacatgcctgcg
agctttacgccggcctttgcggagcgcctggacgccatgtgccagattcgggtcaagcag
gcacaagacggcgatgtcatgcgtcccggggtggccctgttggcccccggcggtatgcaa
accacgctggagcgcggcagccagacaacggtgcgggtgacggagagcccgctgggcacg
atctacaagcccagcgtggatgcggcgttcagctcggcggtcgaggccttgcgcggacag
gtgctggccgtggtgctgaccgggatgggcgcggatggccgcgaaggtgcacgggcgctg
aagggcgccggggcacaggtgtgggcacaggatgcggccacgtcggtggtgtatgggatg
ccggccgcagtcgcggaggccggactcgtggaccatgtgtatccgttgccggatgtgggc
cctgcactggtcaaggggttttgctag

DBGET integrated database retrieval system