KEGG   Thioalkalivibrio sp. K90mix: TK90_1219Help
Entry
TK90_1219         CDS       T01174                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
tkm  Thioalkalivibrio sp. K90mix
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:tkm00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    TK90_1219
   00052 Galactose metabolism
    TK90_1219
   00500 Starch and sucrose metabolism
    TK90_1219
   00520 Amino sugar and nucleotide sugar metabolism
    TK90_1219
Enzymes [BR:tkm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     TK90_1219
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1297191..1298081
Genome map
AA seq 296 aa AA seqDB search
MNPNTPPIRTAVFPVAGMGTRFLPATKANPKEMLPIVDKPLIQYAAEEAVRAGIETLVFV
TGRNKRSIPDHFDKAYELETELEERGKTEMLEKVRNIVPSNVTCVYVRQAEALGLGHAVA
CARPVVRNEPFAVILADDLIEEEQGGATKQMVEAFNQHGCSVLGVEEVPADRTHQYGIID
PVQTGPRTWDVRGIVEKPQPADAPSNVAVVGRYILTPRIFELLAEQEPGAGGEIQLTDAI
AKLLQEERVTALNFEGRRFDCGSKLGYLEATVEFALMHPELKDDFGAYLKSRASTS
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgaacccgaatacgccaccgatccgtaccgctgtttttcctgtcgcgggcatgggcacc
cgctttcttccggccaccaaggccaaccccaaagagatgctccccattgtcgacaagccg
cttattcagtacgcggccgaggaggccgtgcgtgcgggtatcgagaccctggtgttcgtg
accggtcgcaacaagcgttccatccccgatcacttcgacaaggcctacgagcttgaaacg
gagctggaagagcgcggcaagacggagatgctggagaaggtgcgcaatatcgtgccgtcc
aacgtgacctgtgtgtacgtgcgtcaggccgaggcactgggtctgggacatgcggtagcc
tgcgcgcggccggtggtacgcaacgagccctttgcggtgatcctggccgatgacctgatc
gaagaagagcagggcggtgccacgaagcagatggtcgaggcctttaaccagcatggatgc
agcgtgctgggcgtggaagaggtgccggcggaccgcacccatcagtacggcatcattgat
ccggtgcaaacgggcccgcgcacctgggacgtacgcgggattgtggagaagccgcagccg
gcggacgcaccctccaatgtcgcggtcgtgggccgctatatcctgaccccgcgcatcttc
gagctgttggccgagcaggagcccggtgctgggggcgaaatccagctgaccgacgcaatt
gccaagttacttcaggaagagcgtgtaactgcccttaatttcgaaggtcgccgcttcgac
tgtggaagcaagctgggttatctggaggcgactgtggagttcgcgctgatgcacccggag
ctgaaggacgactttggcgcctatctgaaatcccgcgccagcacctcctga

DBGET integrated database retrieval system