KEGG   Thioalkalivibrio sp. K90mix: TK90_1224Help
Entry
TK90_1224         CDS       T01174                                 

Definition
class II aldolase/adducin family protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
tkm  Thioalkalivibrio sp. K90mix
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:tkm00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    TK90_1224
Enzymes [BR:tkm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     TK90_1224
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1301505..1302167)
Genome map
AA seq 220 aa AA seqDB search
MPATDEMALRQGIIDTALETNRRGLNQGTSGNVSARLGDGMLITPSGVPYEALRPEDLVA
VDAQGRWPDHQKPSSEWHFHRAILHARPELNAVVHVHSTYASVVAIQGRDIPALHYMVAA
AGGNSIRCAPYATFGTEQLSRYAVEALQDRLACLLANHGMIATGPDLARALWLTEEVELL
AQQYVLSLQIGGPQLLGDDEMARVLEKFRDYGPSRAAQDG
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgcctgccaccgatgaaatggccctgcgccaggggattatcgacaccgcgctcgagacc
aaccgccgtggtctgaaccaggggacctcgggcaacgtcagcgcgcgcctgggcgatggc
atgctgattaccccgtccggcgtgccctacgaagccctgcgcccggaggacctggtcgcg
gttgacgcacagggacgctggccagatcatcagaagccttccagcgagtggcattttcat
cgggcgatcctccacgcacgcccggagttgaacgccgtggtgcatgtccactcgacctac
gccagcgtggtcgcgattcaggggcgtgatatccccgccctgcactacatggtggcggcg
gccgggggcaattcgatccgttgtgccccttatgccacgttcggcacggagcagctttca
cgctatgcggtggaggccctgcaggaccgactggcgtgcctgctggccaaccacggcatg
attgcgacggggccggatctcgcgcgggccctgtggctgaccgaggaagtcgagctgctc
gcgcagcagtacgtgctgagcctgcaaattggcggcccgcagctcctcggcgacgacgaa
atggcgcgcgtgctggagaagttccgggactacggaccgtcccgggccgcgcaagacggc
tga

DBGET integrated database retrieval system