KEGG   Thioalkalivibrio sp. K90mix: TK90_1243Help
Entry
TK90_1243         CDS       T01174                                 

Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
tkm  Thioalkalivibrio sp. K90mix
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tkm00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    TK90_1243
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    TK90_1243
Enzymes [BR:tkm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     TK90_1243
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1317750..1318793
Genome map
AA seq 347 aa AA seqDB search
MASPVSLPLGPVMLDVNGLELTPEDRERLRHPATGGVILFARNAGTPEQVRALTDAIRAE
RPGILIAVDQEGGRVQRLRDGFTALPPMRELGHVDDYDRNKACELANATGELLALELREA
GIDFSFTPVLDRDIGVSEVIGDRAFHHDPDVIARLAGDLIRGLAAGGMASVGKHFPGHGA
VQADSHIALPVDDRPLAEIEADDIAAFRPVLGDLDAVMPAHVLYPQVDDQPAGFSRIWLQ
DILRRELRFRGAILSDDLAMAGAEAIGSPAERAAAARAAGCDMVLICNQPEQADAILEAQ
QGQPLDAHALGRVEALRAQSIAHDPRRIHALRAQLHHWLAARQAATA
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atggcttctcccgtatccctgcccctggggccggtcatgctcgatgtgaacggtctggaa
ctcaccccggaagaccgtgaacgcctgcgccacccggcgacaggcggcgtcatcctcttt
gcccgcaacgctggtacgccggagcaggtgagggcgctcaccgatgcgatacgcgcggag
cgacccggcatcctgatcgccgtggatcaggagggcggacgcgtgcaacggctgcgggac
ggcttcaccgcgctaccgcccatgcgcgagctggggcatgtcgatgattacgatcgcaac
aaggcctgcgaactcgccaatgcgaccggggaattgctggcgctggagctgcgcgaggcg
ggcatcgatttcagcttcaccccggtactggaccgggacatcggtgtcagcgaggtgatt
ggggatcgtgcgttccaccatgatcccgatgtcatcgcacgcctggccggcgacctgatt
cgcgggctcgcggccggcggcatggccagtgtgggcaagcatttccccggacacggggcc
gtccaggcggattcccatatcgcactcccggtggatgaccgcccgctggccgagatcgag
gccgacgatatcgcggcctttcgcccggtgctgggcgatctcgatgccgtgatgcccgcc
catgtgctgtacccacaggtggatgaccagcccgccggattctcgcggatctggctacag
gacatcctgcgccgcgaactgcggttccgcggggcaattctcagcgatgatctggctatg
gccggtgccgaggccatcggcagcccggccgagcgggccgcggcggcgcgggcggcaggc
tgcgacatggtgctgatctgcaaccagcccgagcaggcagacgccatcctcgaggcgcag
cagggacagccgctcgacgcccacgctttaggaagggtcgaggcgttgcgagcacaatcc
attgcgcatgatcccaggcggattcatgcccttcgcgctcagctgcatcactggcttgcg
gcccggcaggcagcgactgcctga

DBGET integrated database retrieval system