KEGG   Thioalkalivibrio sp. K90mix: TK90_1280Help
Entry
TK90_1280         CDS       T01174                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
tkm  Thioalkalivibrio sp. K90mix
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tkm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TK90_1280
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TK90_1280
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    TK90_1280
Enzymes [BR:tkm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     TK90_1280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1356962..1358104)
Genome map
AA seq 380 aa AA seqDB search
MAFGHRYTGLIERYRDRLPVHDDTRIISLGEGNTPLIRLNNIPRDLAREVEIYVKFEGLN
PTGSFKDRGMTMAVTKAVEEGSRAIVCASTGNTSAAAAAYAARAGITAFVVIPDGKIAMG
KLAQAMMHGATVIQIEGNFDDGMRLVKEVASNTPVTLVNSVNPYRLQGQKTAAFEIVEEL
GRAPDYHCLPVGNAGNITAHWIGYSEMAAKSSDDVTDACSYCKGHCKYAGGGMVGNRPHM
VGYQAAGSAPFMRGAMVDDPDTVATAIRIGHPQSWDMAWKVREESSGWFDECQDDEILAA
QKLLAEKEGVFCEPASAASLAGALRDIREGKIREGSTVVCTLTGNGLKDPDTAIAQSVVQ
PTKVPAELDAVSRAIRDNLA
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atggcctttggacaccgctataccggactgatcgagcgctaccgcgaccgcctgccggtg
cacgacgacacgcgcatcatctcgctgggcgagggcaacacgccgctgatccgcctgaac
aacatcccgcgcgatctggcgcgagaggtcgagatctacgtgaagttcgagggcctgaac
ccgaccggttcgttcaaggatcgcggcatgaccatggcggtcaccaaggctgtggaagag
ggctcgcgcgcgattgtctgcgcctccaccggcaacacctccgccgcggccgccgcctat
gcggcccgggccgggatcaccgcgttcgtcgtcatccccgatggcaagatcgcgatgggc
aagctggcgcaggcgatgatgcacggcgccaccgtgattcagattgaaggcaactttgac
gatggcatgcgcctggtgaaagaggtcgcctccaacacgccggtgaccttggtgaactcg
gtcaatccgtatcgtctgcagggccagaagaccgccgccttcgagatcgtcgaggaactg
ggccgcgccccggactatcactgcctgccggtgggcaacgcgggcaacatcaccgcgcac
tggatcggctacagcgaaatggccgccaagagcagcgacgacgtgaccgatgcctgctcc
tactgcaagggccactgcaagtacgcgggtggtggcatggtgggcaatcgcccgcacatg
gtcggctaccaggcggcgggctccgcgccgttcatgcgcggggcgatggtcgacgacccg
gacaccgtggccacggcgatccgcatcggacacccgcagtcctgggacatggcctggaaa
gtgcgcgaggaatccagcggctggttcgacgagtgtcaggacgacgagatcctggctgct
cagaagctcctggccgaaaaagagggcgtgttctgcgagcccgcgtcggcggcctcgctg
gccggtgccctgcgcgatatccgcgagggcaagattcgggagggttccaccgtggtgtgc
accctcacgggtaacggtctgaaggatcccgacacggccatcgcacagagtgtggtccag
ccgaccaaggtcccggcggagctggacgcggtctcccgagcgatccgcgacaacctcgcc
tag

DBGET integrated database retrieval system