KEGG   Thioalkalivibrio sp. K90mix: TK90_1358Help
Entry
TK90_1358         CDS       T01174                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
tkm  Thioalkalivibrio sp. K90mix
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tkm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TK90_1358
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TK90_1358
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TK90_1358
Enzymes [BR:tkm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     TK90_1358
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1450876..1452075
Genome map
AA seq 399 aa AA seqDB search
MSYLKDFPNQEGFFGEFGGAFLPPELEPHFAEINRAYLALARSADFLNELRYIRKHYQGR
PTPVYYAHNLSREAGAHIYLKREDLNHSGAHKLNHCMGEALLAKHMGKRKLIAETGAGQH
GVALATAAAYFGMECEIHMGEIDIAKEAPNVTRMKLMGAQVVPVSFGGRSLKEAVDSAFQ
SYLSQAEQALFAIGSVVGPHPFPLMVRNFQSVVGIKAREQFMEMTGGELPDHVVACVGGG
SNAMGMFAGFIEDAGVQLNGVEPLGRGTTLGEHSATMTYGKPGMIHGFKCMLLADEEGNP
APVHSIASGLDYPGVGPEHSYLKTIERVAYHAISDDETLEAFYRLSRAEGIIPALESAHA
VAWAMKYGRENPGVTILANLSGRGDKDIDYVTREFGHGD
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtacctgaaggattttccgaaccaggaaggctttttcggcgagttcgggggtgcg
ttcctgccccccgaactggaaccgcattttgccgagatcaaccgggcctacctcgccctc
gcccgctcggccgatttcctgaacgagctgcgctacatccgcaagcactatcagggtcgc
cccaccccggtgtactacgcccacaacctgagccgcgaggccggcgcacatatctatctc
aagcgcgaagacctgaaccactccggagcacacaagctgaaccactgcatgggcgaggcc
ctgctggccaagcacatgggcaagcgcaagctgatcgccgagaccggcgccggccagcac
ggggtcgcgctggccacggcagctgcctacttcggcatggaatgcgagatccacatgggc
gagatcgacatcgccaaggaagcgcccaacgtcacccgcatgaagctcatgggcgcacag
gtcgtgccggtgtccttcggcgggcgctcgctcaaggaggccgtggactccgccttccag
tcctacctgtcgcaagccgagcaggcgctgttcgcgatcggctccgtggtgggtccgcac
cccttcccgctgatggtgcgcaacttccagtcggtggtcggcatcaaggcgcgcgagcag
ttcatggagatgaccggcggggaactgcccgaccacgtggtcgcctgcgttggcggcgga
tccaacgcgatgggcatgtttgccggcttcatcgaggacgccggcgtccagctgaacggg
gtcgagccactcggacgcggcacgacgctgggcgagcactccgccaccatgacctacggc
aagcccggcatgatccacgggttcaagtgcatgttgctggccgacgaggaaggcaacccg
gccccggtccactccatcgcctcgggcctcgactaccccggcgtcggcccggagcactcc
tacctgaagaccatcgagcgcgtggcctaccatgcgatcagcgacgacgaaacgctggag
gccttctatcgactgtcgcgcgccgagggcatcattccggcgctggagagtgcccatgcc
gtcgcctgggcgatgaaatatggccgcgagaatcccggcgtcacgatcctcgccaacctg
tccggccggggcgacaaggacatcgactacgtcacccgcgaattcggccacggcgactaa

DBGET integrated database retrieval system