KEGG   Thioalkalivibrio sp. K90mix: TK90_1530Help
Entry
TK90_1530         CDS       T01174                                 

Definition
1,4-alpha-glucan branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
tkm  Thioalkalivibrio sp. K90mix
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tkm00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    TK90_1530
Enzymes [BR:tkm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     TK90_1530
Exosome [BR:tkm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TK90_1530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1630254..1632464
Genome map
AA seq 736 aa AA seqDB search
MTTASSKCITPVADTLARLPEARLHDPHSVLGCHELDQKTACYRAWLPHASEVSITLSDG
SGEYFTPSTKIPGLFTWQGRASALPRHPELSWKPEDRSDTLRTVDPWSFAPDIPSFDRHL
FAEGRHWHAHRMLGAHPQTRDGIDGVRFAVWAPNAERVSVVGDFNRWDGRCHPMTVHPGS
GIWELFVPGLAMETLYKFEIRNRDHGTIHLKTDPYARAYQVRPETAARIQPQSEYAWGDD
DWLQNRDPEGWKHRPMSIYEVHLGSWQRSPEGHWPNYHDLAERLVPYVRDMGFTHIELLP
VTEHPFDGSWGYQSTGFFAPTSRFGNADDFRYFVDQAHQAGIGVLLDWVPGHFPRDEFAL
ARFDGTALYEHEDPRIGEHRGWGTLIFNYSRPEVRNFLLSSALCWVEDFHIDGLRVDAVA
SMLYRDYDREPHDWLPNIHGGNENLEAVDFLRHLNETVQTEHPGVVMIAEESTAWPGVSR
PPSMGGLGFTMKWNMGWMHDTLTYFGMDPLYRHYHHNQLTFGQIYAYSENFVLPFSHDEV
VHGKRSLRGRMPGNEWEQFANLRLLYAWQWLYPGKKLLFMGQEFGQGPEWSEDRELDWYV
LQYPLHQGLQQLVRDLNRVYRDHAALHGREFEPDGFAWLDCDDAQHSTLSFLRRDTQGRE
SIVVLNLTPVERGAHPVPAPHPGSWRVVLNTDAQAYGGDSRGPAHAHAEPIERNGHPATL
YLHLPPLTALLLEPAD
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
atgacaactgcctccagcaaatgcatcacacccgttgccgataccctggcgcgtttgccg
gaggcgcgtctccatgatccccacagcgtcctcgggtgccatgagctggatcaaaagact
gcctgctaccgtgcctggctgccccatgccagcgaggtctcgatcacactttcggacgga
tccggcgaatacttcacgccgagtaccaaaatccccggactcttcacttggcaaggccga
gccagcgccctccccaggcacccggaactgagctggaaacccgaggaccgcagcgacacc
ctgcgaaccgtcgatccgtggagcttcgcaccggacatcccttcgttcgaccgtcacctg
ttcgccgagggccgccactggcacgcccaccgcatgctcggcgcccatccgcaaacgcgc
gacgggatcgacggcgtgcgtttcgccgtctgggcgcccaatgccgagcgcgtctccgtc
gtcggcgacttcaaccgctgggacgggcgctgccatcccatgaccgtccacccgggcagc
ggcatctgggagctgttcgtccccggccttgccatggagacgctgtacaagtttgaaatc
cgcaaccgtgaccacggcaccatccacctcaagaccgacccctacgcccgcgcctaccag
gtgcgcccggagacggccgcccgcatccagccgcaaagcgagtacgcctggggtgatgac
gactggctgcaaaaccgcgaccccgagggctggaaacaccgcccgatgagcatctacgag
gtgcatctcggctcctggcagcgcagccccgagggccactggcccaactaccacgatctg
gcggaacgcctcgtgccctacgtccgtgacatgggctttacccatatcgagctgctgccg
gtcaccgaacaccccttcgacggatcctggggctaccagagcaccggcttcttcgcgccc
acctcgcgttttggcaacgcggacgactttcgctacttcgtcgaccaggcgcaccaggcc
gggatcggcgtactgctcgactgggtgcccggccacttcccgcgcgacgaattcgccctc
gctcgcttcgacggcaccgcactgtacgaacacgaagacccacgcatcggcgaacaccgg
ggctggggcacgctgatcttcaactattcacgtcccgaggtacgcaacttcctgctctcc
agcgccctgtgctgggtggaggacttccacatcgacggcctgcgcgtggatgccgtcgcc
tccatgctctaccgcgactacgaccgcgaaccgcacgactggctgcccaacatccacggc
ggcaacgagaatctcgaggccgtcgacttcctgcgccacctcaacgagaccgtccaaacc
gagcatcccggcgtcgtgatgatcgccgaagaatccaccgcctggcccggcgtcagccgc
ccgccgtccatgggcggactcggcttcaccatgaaatggaacatgggctggatgcacgac
accctgacctacttcggcatggacccactctaccgccactaccaccacaaccaactcacc
ttcggccagatctacgcctacagcgagaacttcgtcctgcccttctcgcacgacgaagtc
gtgcacggcaaacgcagcctgcgcggccgcatgcccggcaacgaatgggaacagttcgcc
aacctgcgcctgctctacgcctggcagtggctctaccccggcaaaaagctcctgttcatg
ggccaggagttcggccagggcccagaatggtccgaggaccgcgaactggactggtacgtc
ctgcagtacccgctgcaccagggcctgcaacagctcgtgcgcgacctcaaccgcgtctac
cgcgaccacgccgccctgcacggccgcgagttcgaacccgacggcttcgcctggctggac
tgcgacgacgcccaacactccaccctcagcttcctgcgccgcgacacccagggccgcgaa
agcatcgtcgtcctcaacctcacccccgtcgaacgcggcgcccaccccgtgccggcgcct
catcccggctcctggcgcgtcgtcctcaacaccgacgcccaggcctatggcggcgactcc
cgcggccccgcccacgcccacgccgaacccatcgagcgcaacggccaccccgccacgctc
tatctccacctgccgcccctgaccgccctcctcctggaacctgccgattga

DBGET integrated database retrieval system