KEGG   Thioalkalivibrio sp. K90mix: TK90_1799Help
Entry
TK90_1799         CDS       T01174                                 

Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
tkm  Thioalkalivibrio sp. K90mix
Pathway
tkm00790  Folate biosynthesis
tkm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tkm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    TK90_1799
Enzymes [BR:tkm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     TK90_1799
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-ProteinID: ADC72290
UniProt: D3SB85
Position
complement(1916532..1917128)
Genome map
AA seq 198 aa AA seqDB search
MTSAADGRPLPAPEALARHYREILAGLNEDPNREGLLDTPMRAAKAMQYLTRGYHQDLDT
IVNGALFSSDNDEMVLLRDIELYSLCEHHLLPIIGKVHVAYLPNGKVIGLSKIARIVDMF
AARLQIQENMTRQIAEALMQVTDAKGVGVVVDAKHMCMTMRGVEKQHSSMATSVMLGAFR
KDARTRREFLNLIHGSRD
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
gtgaccagcgccgccgatgggcggccgctgccggcccccgaggcgctggcccgtcattac
cgcgagatcctcgccggcctgaatgaagacccgaaccgcgagggcctgctggatacgccg
atgcgggcggccaaggcgatgcagtacctgacccgtggctatcaccaggatctcgacacg
atcgtcaacggggcgttgttcagctccgataacgacgagatggtgctgctgcgcgatatc
gagctgtactcgctgtgcgagcatcacctgttgccgatcatcggcaaggtgcatgtcgcc
tacctgccgaatggcaaggtgatcggcctctccaagatcgcgcgcattgtcgatatgttc
gccgcgcgcctgcagatccaggaaaacatgacccggcagatcgccgaggcgttgatgcag
gtcaccgatgccaagggcgtgggtgtggtcgtggacgccaagcacatgtgcatgaccatg
cgcggggtggagaagcagcactcctcgatggcgacgtcggtgatgctgggtgcgttccgc
aaggatgcgcgcacccgtcgcgagttcctcaacctgatccacggctctcgcgactga

DBGET integrated database retrieval system