KEGG   Thioalkalivibrio sp. K90mix: TK90_1801Help
Entry
TK90_1801         CDS       T01174                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
tkm  Thioalkalivibrio sp. K90mix
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:tkm00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    TK90_1801
  Metabolism of other amino acids
   00480 Glutathione metabolism
    TK90_1801
Enzymes [BR:tkm01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     TK90_1801
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1918028..1918627)
Genome map
AA seq 199 aa AA seqDB search
MARGVEGAVMRRASRFLVVIGLLWTGLASSAAAGEAGALCPASLDFEMRPLTASEPVRLC
ERHAGQVLLVVNTASQCGFTPQYEGLEALNAELHEQGFSVLGFPSGDFAGQEYEDEADIA
EFCRSNYGIQFPMYEKVHASRRHAAPGTLYHYLGTAAGEFPSWNFHKYLIGRDGEVLASF
GTRVTPEDRRLRAAIEAAL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggcccggggtgtggagggtgcagtgatgcgcagggcgagtcggttccttgtggtgata
gggctgttgtggacaggcctggcgtctagcgcggcggcgggcgaggcgggggcgctgtgc
cccgcgagcctcgacttcgagatgcgtccgctgaccgcatccgaacccgtgcgtctttgc
gagcgccatgccggtcaagtgctgctggtggtcaatacggcaagccagtgcggtttcacc
ccgcaatacgagggcctggaggcgttgaacgcggaacttcacgagcaagggttcagtgtg
ctggggttcccctcgggtgacttcgccgggcaggaatacgaggacgaggccgatatcgcc
gaattctgccgctccaactacggcatccagttcccgatgtacgagaaggtgcatgcctcg
cggcgtcacgcggcgcccggtacgctttatcactatctggggaccgcggcgggcgagttt
ccgtcctggaatttccacaagtacctgatcgggcgcgacggcgaggtgctggcctcgttc
ggcacacgggtgacacccgaagaccgacgtctgcgcgccgcgatcgaggctgccctatga

DBGET integrated database retrieval system