KEGG   Thioalkalivibrio sp. K90mix: TK90_1853Help
Entry
TK90_1853         CDS       T01174                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
tkm  Thioalkalivibrio sp. K90mix
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:tkm00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    TK90_1853
DNA repair and recombination proteins [BR:tkm03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      TK90_1853
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1968027..1968617)
Genome map
AA seq 196 aa AA seqDB search
MDAELDELVQALRCLPGVGAKSARRMALHLLERDRDGARRLARAVDQAVERVGHCQVCRT
LTTAEVCSRCADPERDPGVICVVESPGDVMAIESATDFTGRFHVLLGRLSPLDGIGPEEL
GLDRLEARLQEDSVRELILATNTSVEGEVTAHYLAEMAARHGIRATRIAQGIPTGGELEY
IDAGTLAHALSGRREY
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atggacgctgaactcgacgagctggtgcaggcgctacgctgcctgccgggcgtcggtgcc
aaatccgcgcggcgcatggcgctgcacctgctggagcgcgaccgcgatggtgcgcgccgg
ctggcgcgcgcggtcgaccaggcggtcgagcgcgtcggccactgccaggtgtgccgcacg
ctgaccacggccgaggtctgttcccgctgcgcggatccagagcgcgacccgggcgtgatc
tgcgtggtcgagagcccgggcgatgtgatggccatcgaatcggcgaccgactttaccggc
cgcttccatgtcctgctggggcggctgtcgccactggacggtatcggccccgaagagctg
gggctggatcggctggaggcgcgtctgcaggaggacagcgtgcgcgagctgatcctggcg
accaacacctcggtcgagggcgaggtcactgcacactacctggccgagatggccgcgcgt
cacggtattcgtgccacgcggatcgcgcaggggatccccaccggcggcgagctcgagtac
attgacgcgggcaccctcgcgcacgccctgtccggacgccgcgagtactga

DBGET integrated database retrieval system