KEGG   Thioalkalivibrio sp. K90mix: TK90_1879Help
Entry
TK90_1879         CDS       T01174                                 

Definition
(GenBank) succinate dehydrogenase, hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
tkm  Thioalkalivibrio sp. K90mix
Pathway
tkm00020  Citrate cycle (TCA cycle)
tkm00190  Oxidative phosphorylation
tkm00650  Butanoate metabolism
tkm01100  Metabolic pathways
tkm01110  Biosynthesis of secondary metabolites
tkm01120  Microbial metabolism in diverse environments
tkm01130  Biosynthesis of antibiotics
tkm01200  Carbon metabolism
Module
tkm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
tkm_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
tkm_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:tkm00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TK90_1879
   00650 Butanoate metabolism
    TK90_1879
  Energy metabolism
   00190 Oxidative phosphorylation
    TK90_1879
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: ADC72370
UniProt: D3SBG5
Position
complement(1995382..1995720)
Genome map
AA seq 112 aa AA seqDB search
MRLLSGQGAWLLQRITAVYVGLFVILVLGYFLIAPPSDHAAWVAVIAHPAVALGSALFVV
LLLLHAWIGLRDVVLDYVKPLALRLTVLTLGAGALILLGLWALFLLIRTGLA
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
gtgagactgctgtcggggcagggcgcgtggttgctgcagcgcatcacggccgtctatgtc
gggctgttcgtgatcttggtgctgggctatttcctgatcgcccctccatcggatcacgcg
gcctgggtggcggtaatcgcgcacccggctgtggcgttgggcagtgcgctgtttgtcgtg
ctgctgctgttgcatgcgtggatcgggctgcgcgatgtcgtgctcgactacgtgaagcca
ctggcactgcgcctgaccgtgctgaccctcggtgcgggcgcgctcatccttctgggcctg
tgggctcttttcctcctgattcgaacggggcttgcatga

DBGET integrated database retrieval system