KEGG   Thioalkalivibrio sp. K90mix: TK90_1905Help
Entry
TK90_1905         CDS       T01174                                 

Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
tkm  Thioalkalivibrio sp. K90mix
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tkm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    TK90_1905
   00670 One carbon pool by folate
    TK90_1905
Enzymes [BR:tkm01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     TK90_1905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2021122..2021613
Genome map
AA seq 163 aa AA seqDB search
MATPEIHLIVALDPNHVIGRDNDLPWHLPKDLQHFKRVTDGHPMIMGRRTFESIGRPLPK
RRNLVLTRQADWRADGVEVYPDLDSALASIPQGPAFVIGGAGLFAEALPRASVLHLTRVH
EPHAGDTWFPAINPDDWDCVWSERHEPDDRHACAFTFERLERR
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atggcgactcccgagattcacctgatcgtcgcgctggacccgaaccatgtgatcgggcgc
gacaacgacctgccctggcacctgccgaaggacctgcagcacttcaagcgtgtcaccgac
gggcacccgatgatcatgggtcggcgcacgttcgagtccattggccgccccctgccgaaa
cgccgcaacctggtgctcacgcgccaggcggactggcgggcggatggagtggaggtctat
ccggatctcgatagcgccctcgcctccatcccgcagggcccggccttcgtgatcggcggt
gccgggctgttcgccgaggccctgccccgagcctcggtgctgcacctgacccgcgtgcac
gaaccccatgccggggacacctggttcccggccatcaaccccgatgactgggactgcgtc
tggtccgaacgccacgaacccgacgaccgccacgcctgcgcctttaccttcgaacgcctg
gagcgccgctaa

DBGET integrated database retrieval system