KEGG   Thioalkalivibrio sp. K90mix: TK90_2003Help
Entry
TK90_2003         CDS       T01174                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
tkm  Thioalkalivibrio sp. K90mix
Pathway
tkm00230  Purine metabolism
tkm01100  Metabolic pathways
Module
tkm_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:tkm00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    TK90_2003
Enzymes [BR:tkm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     TK90_2003
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_16 AAA_18 MMR_HSR1 RsgA_GTPase AAA_22 ABC_tran AAA_30 AAA_25 AAA AAA_35 cobW AAA_19
Motif
Other DBs
NCBI-ProteinID: ADC72494
UniProt: D3SBZ4
Position
complement(2128148..2128798)
Genome map
AA seq 216 aa AA seqDB search
MTATSQAVRGTLYIVSAPSGAGKTSLVAALLERVEQVEVSVSHTTRKPRAGEVNGEHYHF
VSAEEFLGMIEDGQLLEHAKVFDNFYGTARASVEERLDAGMDVILEIDWQGARQVRAAVP
DAHSIFILPPSRDELERRLRGRGQDSEEVIQRRLRDAESDCTHFREYDYTVVNSDFERAV
SDLASIFRSNRLRTVEQEIRSASTIRNLLASTPGTA
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccacttcccaggccgttcgcggcaccctctatatcgtttccgcgccatcgggc
gcaggcaagaccagcttggttgccgctttgttggagcgggtggaacaggtcgaggtctcg
gtctcgcatacgacgcgcaagccgcgcgccggcgaggtgaacggcgagcactatcacttc
gtctcggccgaggagttcctcggcatgatcgaggatggccaactgctggaacacgcgaag
gtgttcgacaacttctacggtaccgcgcgcgccagcgttgaggaacgcctggatgccggc
atggacgtgatcctggagattgactggcagggcgcgcgccaggtgcgcgcggccgtgccg
gatgcacattcgatcttcatcctgccgccgtcgcgcgacgagctggagcggcgcctgcgc
ggacgcgggcaggacagtgaagaggtgatccagcgccgcctgcgcgacgcggagtccgat
tgcacgcatttccgtgaatatgactacacggtcgtcaactcggatttcgagcgggcggtc
agtgacctggccagcatcttccgctccaaccgtctgcgcacggtggagcaggagattcgt
tccgcatcgacgatacggaatctgttggcgagtacgccgggcacggcgtaa

DBGET integrated database retrieval system