KEGG   Thioalkalivibrio sp. K90mix: TK90_2040Help
Entry
TK90_2040         CDS       T01174                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
tkm  Thioalkalivibrio sp. K90mix
Pathway
tkm00020  Citrate cycle (TCA cycle)
tkm00640  Propanoate metabolism
tkm00660  C5-Branched dibasic acid metabolism
tkm01100  Metabolic pathways
tkm01110  Biosynthesis of secondary metabolites
tkm01120  Microbial metabolism in diverse environments
tkm01130  Biosynthesis of antibiotics
tkm01200  Carbon metabolism
Module
tkm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
tkm_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:tkm00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TK90_2040
   00640 Propanoate metabolism
    TK90_2040
   00660 C5-Branched dibasic acid metabolism
    TK90_2040
Enzymes [BR:tkm01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     TK90_2040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 ATPgrasp_Ter Succ_CoA_lig GARS_A ATP-grasp
Motif
Other DBs
NCBI-ProteinID: ADC72531
UniProt: D3SC31
Position
complement(2162968..2164128)
Genome map
AA seq 386 aa AA seqDB search
MNLHEFQAKARFRDAGIPVPDGQVITHTDELPAAWQALGAERVLVKAQVHSGGRGKAGGV
VMADSPEAAREAAEKLLGSRLVTGQSGPEGLPVDQLLLEPAADIAREFYFALLVDRARER
LALVVSAEGGMDIETLAAERPEAVITLPIHPATGVMPFHGRRVAFALGLSGEPAKAMAQL
VTNAHALFQQVDAQLLEINPLVLTADDQLLAIDAKLTVDDSAAYRQKALMAERDARQRDP
AEEEAHEHDLNYIRLDGSIGCMVNGAGLAMATMDLIKHHGGEPANFLDVGGGTTVERVTA
AFKLILSDPSVKAVLVNIFGGIVRCDLIAEGIIAAIREVQVQVPVVVRLEGTNAEQGREA
LASSGLDVIPAADLDRAARTVVEAVA
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaatctccacgaatttcaggccaaggcgcgctttcgcgacgccggcatccccgttccc
gacggacaggtgatcacccacactgacgaactccccgcggcctggcaggcactgggcgcc
gagcgtgtgctggtcaaggctcaggtgcattccggcggacgcggcaaggccggtggcgtg
gtgatggcggattcccccgaggccgcgcgcgaggcggcggagaagctgctgggctcgcgt
ctggtcaccgggcagagcggccccgagggcctgccggtggatcagctcctgctggagcca
gccgcggacatcgcccgcgagttctatttcgccctgctggtggaccgggcccgcgagcgc
ctggcgctggtggtctccgccgaggggggcatggacatcgaaaccctggccgccgagcgg
cccgaggcggtgatcaccctgccgatccacccggccacgggcgtgatgccgtttcacgga
cggcgggtcgcgtttgccctcgggctgtcgggcgagccggccaaggcgatggcgcaactg
gtgaccaatgcccatgccctgttccagcaggtggatgcgcagctgctggagatcaacccg
ctggtgctgaccgctgacgaccagctgctggccatcgacgccaagctgaccgtggacgac
tccgccgcctaccgccagaaggcgctgatggccgaacgtgacgcgcgccagcgcgacccg
gccgaggaagaggcgcacgagcacgacctcaactacatccgcctggacggctccatcggc
tgcatggtgaacggcgcggggctggccatggccacgatggacctgatcaagcaccacggt
ggcgagccggccaacttcctggatgtcggcggcggcacgacggtggagcgggtcacggcc
gcgttcaagctgatcctgtcggacccctcggtgaaggcggtgctggtgaatatctttggc
ggcattgtgcgctgcgacctgatcgccgagggcatcatcgccgcgatccgcgaggtgcag
gtccaggtgccggtggtcgtgcggctggagggtaccaacgcggaacagggccgcgaggcg
ctggccagctccggtctggacgtgatcccggccgcggacctcgaccgcgcggcgcgcacc
gtggtggaggccgtggcatga

DBGET integrated database retrieval system