KEGG   Thioalkalivibrio sp. K90mix: TK90_2045Help
Entry
TK90_2045         CDS       T01174                                 

Definition
(GenBank) 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
  KO
K00950  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
tkm  Thioalkalivibrio sp. K90mix
Pathway
tkm00790  Folate biosynthesis
tkm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tkm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    TK90_2045
Enzymes [BR:tkm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     TK90_2045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HPPK
Motif
Other DBs
NCBI-ProteinID: ADC72536
UniProt: D3SC36
Position
complement(2167095..2167625)
Genome map
AA seq 176 aa AA seqDB search
MTDAGLQVFVGIGANLGDPEDQVREAFRRLAGDVPQTLLTGQSRLYRNPPMGPQDQPDYV
NAVARLHTRLEPLELLHALQAIEADCGRERDGTRWGPRLLDLDILLYGDQVLDLPGLHVP
HPGLAERDFVVLPLAELAPGLKIPGEGLIERLARRFDGASLVALEDPNVARAGGQR
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgctggtttgcaggtgttcgtgggcatcggcgccaatcttggcgaccccgag
gatcaggtgcgcgaggcctttcggcgcctggccggtgacgtgccgcagacgctgctgacg
gggcagtcgcggctgtaccgaaacccgccgatgggcccgcaggaccagccggactacgtg
aatgccgtggcccggctgcacacccggctcgaacccctggagctgctgcatgcgctgcaa
gcgatcgaggccgactgtggccgcgagcgcgatggcacccgctgggggccgcgcctgctc
gacctggacatcttgctgtacggggatcaggtgctggacctgcccgggctgcatgtaccc
catccgggcctggccgagcgcgacttcgtggtcctgccgctggccgagctggcaccgggt
ctgaagattccgggtgagggcctgatcgagcggctcgcccgccgcttcgatggcgcctcg
ctggtcgcgctggaggacccgaacgttgcccgtgctggagggcagcggtga

DBGET integrated database retrieval system