KEGG   Thioalkalivibrio sp. K90mix: TK90_2103Help
Entry
TK90_2103         CDS       T01174                                 

Definition
disulfide bond isomerase, DsbC/G-like protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
tkm  Thioalkalivibrio sp. K90mix
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2221715..2222428)
Genome map
AA seq 237 aa AA seqDB search
MFVQRALPLAMLLAAFTSTAAATDAIEERMADVIPNAEIDSIQETGMDGIYEVRYGTEIF
YVSGDGKYLLQGNLIDLDTRDNLTQGSLRGVRADMFAEIDDRELVVYSPNGDTRGVLNVF
TDPNCPYCRELHQDIPQYLEAGIKVRYLMFPVLGQNSPEIMDRIWCADDREDAMDRAKTG
DTLDHIDGSCDTPQDAHLALGQQLNVRGTPALITEDGQQMSGYQEPEAVIERIVGGS
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgtttgtacaacgcgcactgcccctggccatgctgctggccgccttcacctccaccgcc
gccgcgaccgatgccatcgaagagcgcatggcggacgtgatccccaatgccgagatcgac
agcatccaggagaccggcatggacgggatctatgaggtgcgctatggcaccgagatcttc
tatgtctccggggatggcaagtacctgctgcagggcaacctgattgacctggatacccgc
gacaacctgacccaagggtcactgcgtggtgtgcgcgctgacatgttcgccgagatcgac
gaccgcgaactggtggtctattcaccgaacggcgacacccgcggcgtgctgaatgtcttt
accgatccgaattgcccctactgccgtgagcttcaccaggacatcccgcagtacctggag
gccggcatcaaggtgcgctacctgatgttccctgtgctgggacagaattccccggagatc
atggaccggatctggtgcgcggatgaccgcgaggacgcgatggaccgcgccaagactggc
gacaccctggaccatatcgacggcagctgcgataccccgcaggatgcacacttggcactg
ggccagcagctgaacgtgcgcgggaccccggccctgatcaccgaggacggccagcagatg
tccggctaccaggagccggaggccgtgatcgaacggatcgtcggcggtagctga

DBGET integrated database retrieval system