KEGG   Thioalkalivibrio sp. K90mix: TK90_2116Help
Entry
TK90_2116         CDS       T01174                                 

Definition
DNA polymerase III subunit chi
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
tkm  Thioalkalivibrio sp. K90mix
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:tkm00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:tkm00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:tkm03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:tkm03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:tkm03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2233876..2234295
Genome map
AA seq 139 aa AA seqDB search
MTHVSFYLLQDPAPEARLRFTCRLAKKASGQGHRVHIHTGSPELTRTLDEWLWTFEDTTF
LPHSTDVRNTDVPVSLHEAHAPSDRCDVLINLAADVPEYCGRFERVADIVGGEESEREAG
RARYRYFKERGYPLKHHNI
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgacccacgtcagcttctacctgctgcaggacccggccccggaggcgcggctgcgcttc
acctgccgcctggcgaaaaaggccagcggccaggggcatcgcgtgcacatccacaccggc
tcgccggagctgacccgcaccctggacgagtggctgtggaccttcgaggacactaccttc
ctgccgcacagcaccgacgtgcgcaacaccgacgtgccggtctccctgcacgaggcccat
gccccttcggatcgctgcgacgtgctgatcaatctggcggccgacgtgccggaatactgc
ggccgcttcgagcgcgtcgccgacatcgtcggcggcgaggagtcggagcgcgaggccggc
cgcgcccgctaccgctacttcaaggaacgcggctacccactgaagcaccacaacatctga

DBGET integrated database retrieval system