KEGG   Thioalkalivibrio sp. K90mix: TK90_2260Help
Entry
TK90_2260         CDS       T01174                                 

Definition
deoxyuridine 5'-triphosphate nucleotidohydrolase Dut
Orthology
K01520  
dUTP pyrophosphatase [EC:3.6.1.23]
Organism
tkm  Thioalkalivibrio sp. K90mix
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tkm00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    TK90_2260
Enzymes [BR:tkm01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.23  dUTP diphosphatase
     TK90_2260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2379614..2380075
Genome map
AA seq 153 aa AA seqDB search
MPVPEIDLKILDPRMGTDFPVPAPATDGSAGVDLRAMIDAPLTLEPGAAELIPTGLSIHI
EDPGYAGMILPRSGLGHKHGLVLGNLVGLIDADYQGPLMVSCWNRGANAYTLEVGERLAQ
LVIVPVVQPQFHVVEDFEETARGIGGFGSSGRG
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgcccgtccccgagattgacctgaagatcctcgacccgcgcatgggcacggacttcccg
gtgcccgcaccggctacagacggctccgccggggtggacctgcgcgcgatgatcgacgcc
ccgctgacactggaacccggcgcagccgagctaatcccgaccggcctgtcgatccatatc
gaggacccgggctacgccgggatgatccttccgcgctccgggctcggccacaagcacggt
ctggtgctgggcaacctggtcggcctgatcgacgccgactaccagggcccgctgatggtc
tcctgctggaaccgaggcgcgaacgcctacacgctggaggtgggggaacgcctggcgcag
ctggtcatcgtaccggtggtccagccgcaattccacgtggtcgaggacttcgaggaaacc
gcacgcggcataggcggcttcggttcctccggtcgcggataa

DBGET integrated database retrieval system