KEGG   Thioalkalivibrio sp. K90mix: TK90_2260Help
Entry
TK90_2260         CDS       T01174                                 

Definition
deoxyuridine 5'-triphosphate nucleotidohydrolase Dut
Orthology
K01520  
dUTP pyrophosphatase [EC:3.6.1.23]
Organism
tkm  Thioalkalivibrio sp. K90mix
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:tkm00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2379614..2380075
Genome map
AA seq 153 aa AA seqDB search
MPVPEIDLKILDPRMGTDFPVPAPATDGSAGVDLRAMIDAPLTLEPGAAELIPTGLSIHI
EDPGYAGMILPRSGLGHKHGLVLGNLVGLIDADYQGPLMVSCWNRGANAYTLEVGERLAQ
LVIVPVVQPQFHVVEDFEETARGIGGFGSSGRG
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgcccgtccccgagattgacctgaagatcctcgacccgcgcatgggcacggacttcccg
gtgcccgcaccggctacagacggctccgccggggtggacctgcgcgcgatgatcgacgcc
ccgctgacactggaacccggcgcagccgagctaatcccgaccggcctgtcgatccatatc
gaggacccgggctacgccgggatgatccttccgcgctccgggctcggccacaagcacggt
ctggtgctgggcaacctggtcggcctgatcgacgccgactaccagggcccgctgatggtc
tcctgctggaaccgaggcgcgaacgcctacacgctggaggtgggggaacgcctggcgcag
ctggtcatcgtaccggtggtccagccgcaattccacgtggtcgaggacttcgaggaaacc
gcacgcggcataggcggcttcggttcctccggtcgcggataa

DBGET integrated database retrieval system