KEGG   Thioalkalivibrio sp. K90mix: TK90_2280Help
Entry
TK90_2280         CDS       T01174                                 

Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
tkm  Thioalkalivibrio sp. K90mix
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tkm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    TK90_2280
Enzymes [BR:tkm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     TK90_2280
Exosome [BR:tkm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TK90_2280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2401553..2402569
Genome map
AA seq 338 aa AA seqDB search
MTAPIAPYPAGRPRRMRRDAFSRRLMREHHLRADDLILPVFVTEGEGVREAVPSMPGVER
VSIDLLLEEAAAAVRLGIPALALFPVVPGEKKSLDAAEAWNPEGLAQRAVRALKQAHPEL
GVITDVALDPFTTHGQDGIIDDDGYVVNDITVEALVKQALSHAAAGADVVAPSDMMDGRI
GAIRTALEDGGHVHTRILAYSAKYASAFYGPFRDAVGSASNLGKGGKETYQMDPANGDEA
LHEVALDLAEGADMVMVKPGMPYLDVVRRIRDEFQRPTFVYHVSGEYAMLKAAAERGWLD
ERACVLEALTGMKRAGADGILTYYARTVAEWLTEDAAR
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcaccgatcgccccctatcccgccggccgtccgcgccgcatgcgccgcgacgcc
ttctcccgccgcctgatgcgcgagcatcacctgcgcgcggacgacctgatcctgccggtg
ttcgtcaccgagggcgaaggggtgcgcgaggcggtgccgtcgatgcccggcgtggagcgc
gtcagcatcgacctgctgctggaggaggcggccgccgccgtgcgcctcggcatcccggcg
ctggccctgttcccggtggtcccgggcgagaagaagagcctggatgccgccgaggcctgg
aaccccgagggcctggcccagcgcgcggtacgcgcgctgaagcaggcccaccccgagctc
ggcgtgatcaccgacgtcgccctggacccgttcaccacccacggccaggacggcatcatc
gacgatgacggctacgtggtgaacgacatcaccgtcgaggcgctggtgaagcaggcgctg
tcgcatgccgcggccggggccgacgtggtcgccccctccgacatgatggacgggcgcatc
ggcgcgatccgcaccgcgctggaagatggcgggcacgtgcacacgcgcatcctcgcctac
tccgccaagtacgcctcggccttctacgggccgttccgcgatgcggtgggctcggccagc
aatctgggcaagggcggcaaggagacctaccagatggacccggccaacggcgatgaggcc
ctgcacgaggtcgcgctcgacctggccgagggcgccgacatggtgatggtcaagccgggg
atgccgtacctggacgtggtccgccggattcgcgacgagttccagcgcccgaccttcgtc
tatcacgtctccggcgagtacgcgatgctcaaggccgccgccgaacgcggctggctggac
gagcgcgcctgcgtgctggaggccctgaccggcatgaagcgcgccggggccgacggcatc
ctcacctactacgcccgcaccgtggccgaatggctgacggaggacgcggcccgatga

DBGET integrated database retrieval system