KEGG   Thioalkalivibrio sp. K90mix: TK90_2358Help
Entry
TK90_2358         CDS       T01174                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
tkm  Thioalkalivibrio sp. K90mix
Pathway
tkm00400  Phenylalanine, tyrosine and tryptophan biosynthesis
tkm01100  Metabolic pathways
tkm01110  Biosynthesis of secondary metabolites
tkm01130  Biosynthesis of antibiotics
tkm01230  Biosynthesis of amino acids
Module
tkm_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tkm00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TK90_2358
Enzymes [BR:tkm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     TK90_2358
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C FMN_dh NanE His_biosynth B12-binding vWA-TerF-like
Motif
Other DBs
NCBI-ProteinID: ADC72848
UniProt: D3SE21
Position
complement(2478700..2479506)
Genome map
AA seq 268 aa AA seqDB search
MNDVPDILKRILERKREELKEREAFWPLRELRGWMGSAPEPRGFRAALQRDIDASRAAVI
AEIKKASPSQGQISPNFNPEAFARSYEEHGATCLSVLTDVDFFKGRDGDLRDARVACKLP
ILRKDFVIDLYQVYEARVLGADCVLLIAAALDDTALHELYFLSRELGMDALVEVHDAEEL
ERAKKVGADLIGINNRDLRTFETRLETTLELKDQVPESALLVTESGIHTREDVARMQEAG
VNAFLVGEAFMRTEDPGLALGRLFRGEA
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacgtcccggacatcctcaagcgtatcctcgaacgcaagcgcgaagagctgaag
gagcgcgaggccttctggccattgcgcgagctgcgtggctggatgggctcggcgcctgag
ccgcgcgggttccgggccgcgctccagcgtgacatcgatgccagccgtgcggcggtgatt
gcggagatcaagaaggccagccccagccaggggcagatcagcccgaacttcaaccccgag
gcctttgcccgcagctacgaggaacacggggccacctgtctgtcggtgctgaccgacgtg
gacttcttcaagggccgggatggggacctgcgcgatgcgcgtgtggcctgcaagctgccg
atcctgcgcaaggatttcgtgatcgacctgtatcaggtctacgaggcgcgggtgctggga
gccgactgcgtgctgctgatcgccgccgcgctggacgacaccgcactgcacgagctgtat
ttcctgagtcgcgagctgggcatggatgccctggtcgaggtgcacgatgccgaggagctc
gagcgcgcgaagaaggtcggcgcggatctgatcggcatcaacaaccgcgatctgcgtacc
ttcgagacgcggctggagaccacgctggagctgaaggatcaggtgcccgagtccgcactg
ctggtcaccgagagcgggattcatacccgcgaggatgtggcgcgcatgcaggaggcgggg
gtgaatgccttcctggtgggcgaggccttcatgcgtaccgaggatccgggactggcgctg
ggccgtctgttccgcggcgaggcataa

DBGET integrated database retrieval system