KEGG   Thioalkalivibrio sp. K90mix: TK90_2409Help
Entry
TK90_2409         CDS       T01174                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
tkm  Thioalkalivibrio sp. K90mix
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tkm00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    TK90_2409
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    TK90_2409
Enzymes [BR:tkm01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     TK90_2409
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2531379..2532401
Genome map
AA seq 340 aa AA seqDB search
MSDTVDTPVLAGATRLPEPGPLPNHLQLTDDGQLRHLLTIEGLNRDLLNEILDTAESFAN
MNEKAVKKVPLLRGKTIVNLFFEASTRTRTTFELAAKRLSADVLNINISTSSAVKGESLL
DTLRNLEAMNVDMFVVRHEESGTAHFIARHVAPGISVLNAGDGRHAHPTQALLDMFTIRR
HKGDFTKLKVAIVGDILHSRVARSQIHALNILQTGEVRVVAPCSLLPANVDQLGVHVYND
LDAGLKDVDVIIMLRLQRERMEHAHLPSEHEYYQLFGLTSRRLQLAHPTCLVMHPGPANR
GVEIESAVADGPHSVILQQVTYGISVRQAVMSMVMGAHQS
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgagcgataccgtggacaccccggtcctggccggggccacccgcctgccggaaccgggc
ccgttgcccaatcacctgcagctgaccgatgacggccagctgcgccacctgctgaccatc
gagggcctcaaccgcgatctcctgaacgagatcctggataccgccgagtcgttcgcgaac
atgaacgagaaggcagtgaagaaggtcccgctgctgcgcggcaagaccatcgtcaatctg
ttcttcgaggccagcacccgcacccgcaccaccttcgaactggccgccaagcgcctgtcc
gcggacgtactcaacatcaacatcagcacttcctcggcggtcaagggcgaaagcctgctg
gataccctgcgcaacctcgaggcgatgaacgtggacatgttcgtggtacgccacgaggag
agcgggaccgcgcatttcatcgcccgccatgtcgcccccggcatcagcgtgctgaacgcc
ggcgacggccgccacgcgcaccccacccaggcgttgctggacatgttcaccatccgccgg
cacaagggcgacttcaccaagctgaaggtcgcgatcgtgggcgacatcctgcactcgcgc
gtcgcgcgctcgcagatccacgcgctcaacatcctgcagaccggcgaagtacgtgtggtc
gcaccctgttcgctgttgccggcgaatgtcgaccaactcggcgtgcacgtctacaacgac
ctcgacgccggcctgaaggacgtcgacgtgatcatcatgctgcgtctgcagcgcgagcgc
atggagcacgcccatctgccctccgagcacgagtactaccagctgttcggcctgacctcg
cgccgtctgcaactggcgcaccccacctgcctggtgatgcacccgggcccggcgaatcgc
ggcgtggagatcgagtccgcggtggcggacgggccgcactcggtgatcctgcagcaggtg
acctacggcatctcggtccgccaggccgtgatgtccatggtgatgggggcgcatcagtcg
tga

DBGET integrated database retrieval system