KEGG   Thioalkalivibrio sp. K90mix: TK90_2520Help
Entry
TK90_2520         CDS       T01174                                 

Definition
Asparagine synthase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
tkm  Thioalkalivibrio sp. K90mix
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:tkm00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2651477..2653339)
Genome map
AA seq 620 aa AA seqDB search
MAGLCGWFGSPREAAGNILGLQEAGLPSVPGESSARCDGPRGGCLVQGGWVAQAPDGLIA
AVAGHPRWRERGLQRLALQQSPGHALLDAYRRFGDALFSQLAGDFVVAILDPQRPRLLAG
VDRMGQASLHWAAVPGGVVFGTTAGSVVRYPGLSRDPTPSGLYHYLFFHMLPAPVSVFAG
VEKLRAAHYLDRQADTIRVRSYWVPHFREARMGDAAEMGTALRDQLRNAVKQQQETPKPG
AFLSGGLDSSTVAGLLAETTPEPPPTFSIGFDAPGYDEMEYARIAARHFATQANEYYVTP
DDVVAAVPLIAGSYDEPFGNSSALPAYFCARMAAQAGVTRLLAGDGGDELFAGNARYAKQ
GLFEHWQRLPRTLRQGMLEPLATRIPQGAGWLSKARRYVEQARIPLPDRLQTYNYLYHLS
PTAMFEPDFLAAVDTRAPWDLMREIHDQPAHASSLNRMMYLDWQQTLADNDLRKVTRMCE
LAGVDVVFPMLDDDVVEFSLGIPSDQKLRGQRLRHFYKEAMQGFLPDAIIDKKKHGFGLP
FGVWMHDHAPLRELAYDSLLRLKGQGFLRPQFIDELIALHRDGHAAYYGDMVWVLMMLDL
WLHAPPSEMPAEARAQAGGY
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atggcgggactatgtggatggtttgggtcgcccagggaggcggcgggcaatatcctcggc
ctgcaggaggccgggctcccttcggtcccgggtgagtccagtgcgcgctgtgatggcccc
cggggcgggtgtctggtccagggcggctgggtggcccaggccccggatgggctgatcgcg
gccgtcgccggccacccccggtggcgggagcgcggcctgcagcgcctggcgctgcagcag
tcgcccggacatgccttgctggacgcctaccggcgtttcggcgatgccctgttcagccag
ctggcgggggatttcgtggtggcgatcctggacccgcagcggccgcgcctgctcgcgggc
gtggaccgtatggggcaggcctcgctgcactgggcggcggtgccgggcggggtagtcttc
gggaccactgcgggcagtgtggttcgctatcctggtctgagccgcgacccgaccccctcg
gggctttatcactacctcttcttccacatgttgcccgcaccggtcagtgtgttcgcgggc
gtcgagaagctgcgcgccgcgcactacctggaccgccaggcggacaccatccgcgtgagg
tcgtactgggtcccgcattttcgcgaggcgcgcatgggcgatgccgccgagatgggcacg
gccctgcgggatcagctgcgcaatgccgtcaagcagcagcaggagacgccgaagccgggg
gcctttctcagcggagggctggacagttcgaccgtggccgggctcctggccgagaccacc
cccgagccgccgccgacattcagcatcggtttcgatgccccgggttacgacgagatggag
tacgcccgcatcgcggcccggcactttgcgacccaggcgaacgagtactacgtgacgccg
gacgatgtcgtcgctgccgtccccctgattgccggcagttatgacgagccctttggcaac
tcctcggcactgcctgcctatttctgtgcccgcatggcggcacaggcgggcgtgacccgg
ctgctggccggtgatggtggcgacgagctgtttgccggcaacgcacgctatgccaagcag
ggcctgttcgagcactggcagcgcctgccgcgcaccttgcgccagggcatgctggaaccc
ctggcgacccgcatcccccagggggccggctggctgagcaaggcgcgccgctatgtggag
caggcgcgcatcccgctgcccgatcggctgcagacctacaactacctgtaccacctctcg
cccacggcgatgttcgaaccggactttctcgcggcggtggatacccgggccccgtgggat
ttgatgcgcgagatccacgaccagccggcacacgcctcgtcgctgaaccgcatgatgtac
ctggactggcagcagaccctggccgacaacgacctgcgcaaggtcactcggatgtgcgag
ctggccggcgtggatgtcgtctttccgatgctggacgacgacgtggtggaattctccctg
ggcatcccgtccgaccagaaactgcgcgggcagcggctgcgccacttctacaaggaggcg
atgcagggcttcctgcccgacgccatcatcgacaagaagaagcatggctttggtctgccc
ttcggggtgtggatgcacgaccacgcgccactgcgcgaactggcctatgacagcctgctg
cgcctcaaggggcagggctttttgcggccgcagttcatcgacgaactgatcgcgctgcac
cgcgacggacacgcggcctactacggcgacatggtgtgggtgctgatgatgctggatctc
tggctgcacgccccgccgagcgagatgccggccgaagcgcgcgcccaggcgggcggttac
tga

DBGET integrated database retrieval system