KEGG   Thermococcus kodakarensis: TK0244Help
Entry
TK0244            CDS       T00226                                 

Gene name
hisD
Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
tko  Thermococcus kodakarensis
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:tko01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:tko00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
205074..206204
Genome map
AA seq 376 aa AA seqDB search
MKGLEEYVREILEDIRRRGLEALREYSERFDNYSGPFRVSEGEFEEAEELVPEEDKRVIE
ETMERLWEYHARQFRDVELYIKRGSLYGLIYRPIGRIGIYVPGGKPLPSTLMMVGIPARI
AGVREIAVTTPPKDGKVNPYVLYVAKLLGIEEVYKLGGVGAIAAMAYGVGMRRVDKIFGP
GNRFVNEAKRQVFGIVGIDSLAGPSEIAVIADESADKDYVLADLLSQLEHGKDSKAWLLT
TSRELADYCSREGIEVLLCRNLEECAEKANEIAPEHLEIITENPEELVDLIENAGAIYLG
PYTPVPAADYFLGVNHVLPTGGAARFSGVLTVMDFMKPITLARVSREEFLAYRRLGMRLA
EIEGMEAHRRSLEVRR
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgaaggggcttgaagaatacgttagggaaatcctggaggacatcaggagaaggggcctt
gaggccctgagggagtactcggaaaggttcgacaactactcgggcccgttcagggtttcg
gagggggagttcgaggaggcagaggaactcgtgccagaggaggacaagagggtaatcgag
gagacgatggagcgcctctgggagtaccacgcgaggcagttcagggatgtagagctctac
atcaagaggggctctctctacggccttatatatcgcccgatagggaggatagggatatac
gttcccgggggaaagccgctcccgtcgacgctcatgatggtcgggattccagccagaata
gccggggtcagggagatagcagtcacgacgccgcccaaagacgggaaggtgaacccctac
gttctctacgtggcaaaactgctcgggatcgaggaggtctacaagctcggcggggtgggg
gcaatagcggcgatggcctacggggttggcatgaggagggttgacaagatattcgggccc
gggaacaggttcgtcaacgaggccaagaggcaggtgttcggcattgttggaatagacagc
ctcgcagggccttctgagatagccgtgatagccgatgagagtgcagataaggattacgtg
ctcgccgatctcctcagtcagctcgagcacgggaaggacagtaaggcatggctcctgacc
acctccagggagctcgcagattactgctcaagggaggggatagaggttctcctatgcagg
aacctggaggaatgcgccgagaaggccaacgagatagcccccgagcaccttgagataata
accgaaaaccctgaggagctcgttgacctcatcgagaacgctggagccatctacctcggc
ccctacactcccgtcccagcagccgactacttcctcggcgttaaccacgtcctcccaaca
ggaggagcggccaggttcagcggggttctgacggtgatggacttcatgaagcccataacc
ctcgcgagggtgagcagggaggagtttttggcctacagaaggctcgggatgaggctggct
gagatagagggaatggaagcccacaggaggagcctggaggtgaggagatga

DBGET integrated database retrieval system