KEGG   Thermococcus kodakarensis: TK0257Help
Entry
TK0257            CDS       T00226                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
tko  Thermococcus kodakarensis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tko00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TK0257
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TK0257
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TK0257
Enzymes [BR:tko01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     TK0257
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
215430..216599
Genome map
AA seq 389 aa AA seqDB search
MDDMFFGRFGGQFVPETLIEPLKKLERAYKKFKDDPEFNETLEYYLRNWAGRPTPLYYAE
RLSKKLGGAKIYLKREDLLHGGAHKTNNGIGQALLAKFMGKERLIAETGAGQHGVATAMA
GALLGMKVDVYMGAEDVERQKMNVFRMGLLGARVIPVESGSRTLKDAINEALRDWVATFE
YSHYLIGSVVGPYPYPVIVRDFQSVIGREAREQILEAEGTLPDAVVACVGGGSNAMGIFY
PFVNDRVRLIGVEAGGKGLETGLHAASLNAGELGVFHGMLSYFLQNEEGQITPTHSVSAG
LDYPGVGPEHAYLKDSGRAEYVTVTDEEALRAFHELSRTEGILPALESAHAVAYAMKIAP
EMDKDEIIIVNLSGRGDKDLDIVRRVGNV
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atggatgatatgttcttcggaaggtttgggggccagttcgtccccgagacgcttatagaa
cctttgaagaagcttgaaagggcttacaaaaagttcaaggacgaccctgagttcaacgaa
accctcgagtactacctgcggaactgggcgggaaggccgacgcccctctactacgcggag
aggcttagcaaaaagctgggaggggcgaagatatacctcaagagggaggacctcctccac
ggcggggcccacaagacgaacaacggcatagggcaggccctcctcgccaagttcatgggc
aaggagaggctcatagccgagaccggggcgggccagcacggcgtcgccacggccatggcg
ggggcgctcctcgggatgaaggtagacgtttacatgggcgccgaagacgtcgagaggcag
aagatgaacgtcttccgcatggggctgctcggcgcgagggttattcccgtcgaaagcggc
tcaagaaccctgaaggatgccataaacgaggccctccgcgactgggttgccaccttcgag
tactcccactacctaataggctcggttgtcgggccctacccatacccggtcatcgtgagg
gacttccagtcggtaataggcagggaggccagggagcagatactcgaagccgaggggacg
ctaccggatgcggtagtggcatgtgtcgggggcgggagcaacgcaatgggcatcttctac
cccttcgtgaacgatagggtcaggctcataggcgtcgaagccgggggaaagggcctcgaa
acgggcctccacgcggcctcgctgaacgccggcgagctcggcgttttccacggcatgctc
agctacttcctccagaacgaggagggccagataactcctacccacagcgtttcggcgggg
ctcgactacccgggagttggtcccgagcacgcctacctcaaggatagcggaagggccgag
tacgtcacggtgaccgacgaggaggctctgagagccttccacgagctttccaggacggag
ggaatacttccagcgctcgaatcggcccacgcggtagcctacgcgatgaaaatagcccca
gagatggataaagacgagataatcatagtcaacctctctgggaggggcgacaaggacctg
gatatagtcaggagggtcgggaatgtttga

DBGET integrated database retrieval system