KEGG   Thermococcus kodakarensis: TK0258Help
Entry
TK0258            CDS       T00226                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
tko  Thermococcus kodakarensis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tko00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TK0258
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TK0258
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TK0258
Enzymes [BR:tko01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     TK0258
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
216592..217347
Genome map
AA seq 251 aa AA seqDB search
MFEKGSLIPYLTAGDPSVEKTLEFLLAVEEFAGLIELGIPFSDPMADGKTIQESHYRALR
NGFKLDDTFRILREFRRHSSTPVILMTYYNPVFRTGVKKFLGEAKASGADGILVVDLPVS
HAGEFLDAAKEEGLKTVFLAAPNTPDERLREIDKASTGFVYLISLYGTTGARDRLPETAF
EFVRRARKICNNKLAVGFGVSRREQVEELLKAGADGVVVGSALIELISRSENPVEELRRK
VAELSGYSRAL
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgtttgagaagggctcgctgattccctatctcacggccggcgacccgagtgtcgaaaag
acccttgagtttttactagcggtcgaagagttcgccggtctaatagagctcggaatcccc
ttcagcgacccgatggcggacgggaagacgatccaggagtcccactaccgcgccctgagg
aacggcttcaaactcgatgataccttcaggatcctccgcgagttcaggaggcactcctct
accccagtaattctgatgacctactacaacccggttttcaggacgggcgttaagaagttc
ctcggagaggctaaggccagcggggccgacgggatcctcgtggttgaccttcctgtgagc
catgcaggggaattcctcgatgcggccaaggaagaggggctaaagacagtatttcttgca
gccccaaacactcccgatgaaaggcttagggagatagataaagcctctaccggcttcgtc
taccttatctccctgtacgggaccactggagcccgcgacagacttcccgagacggctttc
gagttcgtgaggcgcgccagaaagatatgcaacaacaagctggcagtcggcttcggtgtt
tcgaggagggagcaggtggaggagcttttgaaggctggagccgacggggttgtcgttgga
agcgcgcttatagagctaatatcccgcagtgagaaccccgtggaggagctgaggagaaag
gtggcggagctctcgggctactccagagctctgtag

DBGET integrated database retrieval system