KEGG   Thermococcus kodakarensis: TK0258Help
Entry
TK0258            CDS       T00226                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
tko  Thermococcus kodakarensis
Pathway
tko00260  Glycine, serine and threonine metabolism
tko00400  Phenylalanine, tyrosine and tryptophan biosynthesis
tko01100  Metabolic pathways
tko01110  Biosynthesis of secondary metabolites
tko01130  Biosynthesis of antibiotics
tko01230  Biosynthesis of amino acids
Module
tko_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tko00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TK0258
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TK0258
Enzymes [BR:tko01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     TK0258
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth Ribul_P_3_epim PcrB TMP-TENI Radical_SAM FMN_dh NMO IGPS G3P_antiterm NanE QRPTase_C BtpA
Motif
Other DBs
NCBI-ProteinID: BAD84447
UniProt: Q9YGA9
Position
216592..217347
Genome map
AA seq 251 aa AA seqDB search
MFEKGSLIPYLTAGDPSVEKTLEFLLAVEEFAGLIELGIPFSDPMADGKTIQESHYRALR
NGFKLDDTFRILREFRRHSSTPVILMTYYNPVFRTGVKKFLGEAKASGADGILVVDLPVS
HAGEFLDAAKEEGLKTVFLAAPNTPDERLREIDKASTGFVYLISLYGTTGARDRLPETAF
EFVRRARKICNNKLAVGFGVSRREQVEELLKAGADGVVVGSALIELISRSENPVEELRRK
VAELSGYSRAL
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgtttgagaagggctcgctgattccctatctcacggccggcgacccgagtgtcgaaaag
acccttgagtttttactagcggtcgaagagttcgccggtctaatagagctcggaatcccc
ttcagcgacccgatggcggacgggaagacgatccaggagtcccactaccgcgccctgagg
aacggcttcaaactcgatgataccttcaggatcctccgcgagttcaggaggcactcctct
accccagtaattctgatgacctactacaacccggttttcaggacgggcgttaagaagttc
ctcggagaggctaaggccagcggggccgacgggatcctcgtggttgaccttcctgtgagc
catgcaggggaattcctcgatgcggccaaggaagaggggctaaagacagtatttcttgca
gccccaaacactcccgatgaaaggcttagggagatagataaagcctctaccggcttcgtc
taccttatctccctgtacgggaccactggagcccgcgacagacttcccgagacggctttc
gagttcgtgaggcgcgccagaaagatatgcaacaacaagctggcagtcggcttcggtgtt
tcgaggagggagcaggtggaggagcttttgaaggctggagccgacggggttgtcgttgga
agcgcgcttatagagctaatatcccgcagtgagaaccccgtggaggagctgaggagaaag
gtggcggagctctcgggctactccagagctctgtag

DBGET integrated database retrieval system