KEGG   Thermococcus kodakarensis: TK0352Help
Entry
TK0352            CDS       T00226                                 

Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K18931  
AMP phosphorylase [EC:2.4.2.57]
Organism
tko  Thermococcus kodakarensis
Brite
Enzymes [BR:tko01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.57  AMP phosphorylase
     TK0352
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
295120..296631
Genome map
AA seq 503 aa AA seqDB search
MKAKIRILDMFSGRYTVLINEEDAKEAKLHPDDLVKIEAGKKAVYGSVALSNLVGKGEVG
ISRDVLDLHNFSEGETVSVIPAGTPESVRYIKKKMHGEKLRKVEIEAIVRDIVDRKLRDI
EISSFVTALEINGLDMDEIAALTIAMAETGDMLDIDRKPIMDVHSIGGVPGNKTNILVVP
IVAAAGLTIPKTSSRAITSAAGTADVVEVFADVSFSLDEIKRIVEKVGACLVWGGALNLA
PADDITIKAERALSIDPTGLMLASIMSKKYAMGSQYVLIDIPTGKGVKVETVEEARSLAR
DFIELGKRLGQYVEVAITYGGQPIGHTVGPALEAREALSALMTGKGPGSLIEKATGLAGI
LLEMGGVAPAGTGKKMAKEILESGKAWEKMKEIIEAQGGDPNIKPEEIPIGDKTYTFTAA
TSGYVTAIDNRAITAIARAAGAPEDKGAGIELYVKVGEKVKEGDPLFTIHAEHEARLDQA
IVLARRTEPIRIEGMVLQRIGNI
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagccaagatccgcatactcgatatgttcagtgggaggtacactgttctaataaac
gaggaagatgccaaggaggcaaagcttcacccggacgacctcgttaagatagaggcaggt
aagaaggccgtctatggcagcgttgccctcagcaacctcgtcggaaagggtgaggtcggt
ataagcagggacgtacttgaccttcacaacttctcggagggcgaaaccgtcagcgttatc
cctgccgggactccagagagcgtccgctacatcaagaagaagatgcacggcgagaagctc
aggaaggtcgagatagaggccatcgtgagggacatcgttgacaggaagctcagggacatc
gagataagctccttcgtgacggcccttgagataaacggcctcgacatggacgagatagcg
gctctgaccatagcgatggcagagacgggggacatgctcgatattgatcggaagccgata
atggacgtccacagcatcggcggcgtcccgggaaacaaaaccaacattctcgtcgtcccg
atagtggcggcggcaggtttaactattccaaagaccagctcaagggctatcaccagcgcc
gcgggaactgccgacgttgtcgaggtttttgcggacgtcagcttctccctcgacgagata
aagcgcatcgtcgagaaggtcggggcatgtctggtctggggcggtgcgctcaacctggca
cccgcggatgacataacgataaaggccgagcgtgcgctgagcatcgaccccactggcctg
atgctggccagcataatgtcaaagaagtacgctatgggcagtcagtacgttctcattgac
atcccgactggaaagggtgttaaggtggagactgtcgaggaggccaggagccttgccagg
gacttcatagagcttggaaagaggctcggccagtacgttgaggttgcaataacctacggt
ggtcagccaataggacacaccgtcggccctgccctcgaagccagggaggccctctccgct
ctcatgactggcaaaggccctggaagcctaatagaaaaggccacaggactggccggaata
ctccttgagatgggtggcgttgcacccgccggaactggcaagaaaatggccaaagaaatc
ctcgagagcggcaaggcctgggaaaagatgaaggaaatcatcgaggcccagggcggagac
ccgaacatcaagcccgaggagatacccatcggcgacaagacctacaccttcaccgccgcc
acgagcggttacgtcacagcaatagacaacagggcgataactgccatagcgagggccgct
ggagcgcctgaggacaagggagctggaatcgagctctacgtcaaggtcggggaaaaggtc
aaggagggcgacccgctcttcacgatacacgccgagcacgaggcgaggctcgaccaggcg
atagtcctcgccagaaggactgaaccgataagaatagaaggaatggttctccagcgaatc
ggcaacatctga

DBGET integrated database retrieval system