KEGG   Thermococcus kodakarensis: TK0781Help
Entry
TK0781            CDS       T00226                                 

Definition
deblocking aminopeptidase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
tko  Thermococcus kodakarensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tko00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    TK0781
Enzymes [BR:tko01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     TK0781
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
680715..681761
Genome map
AA seq 348 aa AA seqDB search
MVDYELLKKIVEAPGVSGFEFLGVRDVVIEAFKPYVDEIKVDKLGNVIAHKKGNGPKVML
AAHMDQIGLMVNHIEKNGFLRVVPVGGVDPRTLIAQRFKVWIDKDKFIYGVGGSVPPHIQ
KPEERSKAPTWDQVFIDIGAESKEEAEEMGVRVGTIITWDGRLERLGKHRLVSIAFDDRI
AVYTLVKAAQELGETDADIYFVATVQEEVGLRGARVSAFGIDPDYGFAIDVTIAADVPGT
PEHKQVTQLGKGTAIKIMDRSVICHPTIVRWMEELAKKYEIPYQWDILLGGGTDAGAIHL
NKSGVPTGAISVPARYIHSNAEVVDERDVDAGVKLMVKVLEHIGELEL
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atggtcgactacgaactgctcaagaagatagttgaggcccctggtgtttcgggttttgag
tttctcggcgtcagggacgtcgttatagaggccttcaagccctacgtggacgagataaag
gttgacaagctcggcaacgtcatagcccacaagaagggcaacggcccaaaggttatgctc
gcggcacacatggatcagatcggcctcatggtgaaccacatcgagaagaacggcttcctc
cgcgtcgtcccggtcggcggcgttgacccgaggactctcatagcccagcgcttcaaggtc
tggattgacaaggataagttcatctacggtgtcggcggaagcgttcctccgcacatccag
aagcccgaggagaggagcaaggctcccacctgggaccaggtcttcattgacatcggcgcc
gagagcaaggaagaggccgaggagatgggtgtcagagtgggaaccataatcacctgggac
ggcagacttgagaggctcggaaagcacaggctcgtcagcatagccttcgacgacaggata
gctgtttatactctcgttaaagccgcccaggagcttggcgagaccgatgcggacatctac
ttcgtcgccaccgtccaggaagaggtcggactcaggggtgcgagggtctcggccttcggc
atcgacccggactacggcttcgccattgacgttaccatagcggccgacgtccctggaacg
ccggagcacaagcaggtcacccagctcggaaagggtaccgcaatcaagataatggaccgc
tcggtcatctgccatccaacgatcgtccgctggatggaggagctcgccaagaagtacgag
ataccctaccagtgggacattctcctcggcggcggaactgacgcaggggccattcacctc
aacaaatccggtgttccgaccggagccatcagcgttccggcgcgctacatccactccaac
gcagaggtcgttgatgagcgcgatgttgacgctggagtcaagctgatggtcaaggttctg
gagcacatcggagagcttgagctttga

DBGET integrated database retrieval system