KEGG   Thermococcus kodakarensis: TK1008Help
Entry
TK1008            CDS       T00226                                 

Definition
Fe-containing alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
tko  Thermococcus kodakarensis
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:tko00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    TK1008
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TK1008
  Lipid metabolism
   00071 Fatty acid degradation
    TK1008
  Amino acid metabolism
   00350 Tyrosine metabolism
    TK1008
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    TK1008
   00626 Naphthalene degradation
    TK1008
Enzymes [BR:tko01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     TK1008
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
880516..881652
Genome map
AA seq 378 aa AA seqDB search
MFWLKTRISEGEDSLESLKDEAKDHERVLILASGSMKRHGFLSEAEDYVREAGAEVMSIS
GLPAEPSVEVIEEFLPKVREFGPDLLIAMGGGSVIDTTKALKVFYDAPELVFEEIAFINR
FSRPKPVPKLKTPLIAIPSTSGAGSEVSAASVLKKNGIKYNIVTPEIAPEVAILDPRLPR
TMPREVARNSGLDVLVHGIEAYTTKVAGPFSDAMAIRAIKTVFEWLPKSVEGDPEARARM
HYAATMAGIAFLNARLGLAHAMSHKAAWVGPHGLLNAIFIPYVMEFNAERSEYARKRYAE
IARELGLKSAEELIKAVRELNERLGVPKLSELVDEETFVERVEEMAEKAYRDGLIAFNPV
EPKPEEIRELYLKALNAL
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
gtgttctggctcaagacgaggataagtgagggggaggactcactagagagcctcaaggac
gaggccaaggatcacgaacgggttctcatactggcatctggttctatgaagaggcacggc
tttctaagcgaggccgaggactacgttagggaagccggagcagaggttatgagtatatca
ggacttccggcggagccgagcgttgaggtcattgaggagttcctgccgaaggttagggag
tttgggcccgatctcctcatagccatgggcggcggcagcgttatcgacacgaccaaagcc
ctcaaggtcttctacgatgcccccgagctcgtctttgaggagatagccttcatcaaccgt
ttctcaaggccgaagcccgttccaaaactaaaaactcccctcatcgcgattccctcaacg
agcggagctggaagcgaggtttccgcggccagtgtcctgaagaagaacgggataaagtac
aacatcgtaacgccggagatagcacctgaggtagctattctcgacccgaggctcccgagg
actatgccaagggaagttgcgaggaattctggcctggatgtcctcgtccacggtatagag
gcttacacaactaaggtcgctgggcccttcagcgatgcgatggcgataagggcgataaag
accgtcttcgagtggcttccgaagtcggttgaaggtgaccccgaggcgagggcaagaatg
cactacgcggcaacgatggcagggatagcctttctcaatgccaggcttggtttggcccac
gcgatgagccacaaggcggcatgggtaggtccccatggcttactcaacgcgatattcata
ccctacgtgatggagttcaacgccgagaggagtgagtatgcgaggaagcgctatgctgag
atagcgcgcgaacttgggttgaagagtgctgaagagctgataaaagccgtcagagagctc
aacgagcgccttggagttccaaagctaagcgagcttgttgatgaagagacttttgttgaa
agggttgaggagatggctgaaaaggcctaccgcgacgggctgatagcgttcaaccccgtt
gaaccaaagccagaggagataagagagctttatctgaaggctttgaacgcgttatag

DBGET integrated database retrieval system