KEGG   Thermococcus kodakarensis: TK1008Help
Entry
TK1008            CDS       T00226                                 

Definition
Fe-containing alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
tko  Thermococcus kodakarensis
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:tko01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:tko00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:tko00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:tko00350]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:tko00625]
Metabolism; Xenobiotics biodegradation and metabolism; Naphthalene degradation [PATH:tko00626]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
880516..881652
Genome map
AA seq 378 aa AA seqDB search
MFWLKTRISEGEDSLESLKDEAKDHERVLILASGSMKRHGFLSEAEDYVREAGAEVMSIS
GLPAEPSVEVIEEFLPKVREFGPDLLIAMGGGSVIDTTKALKVFYDAPELVFEEIAFINR
FSRPKPVPKLKTPLIAIPSTSGAGSEVSAASVLKKNGIKYNIVTPEIAPEVAILDPRLPR
TMPREVARNSGLDVLVHGIEAYTTKVAGPFSDAMAIRAIKTVFEWLPKSVEGDPEARARM
HYAATMAGIAFLNARLGLAHAMSHKAAWVGPHGLLNAIFIPYVMEFNAERSEYARKRYAE
IARELGLKSAEELIKAVRELNERLGVPKLSELVDEETFVERVEEMAEKAYRDGLIAFNPV
EPKPEEIRELYLKALNAL
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
gtgttctggctcaagacgaggataagtgagggggaggactcactagagagcctcaaggac
gaggccaaggatcacgaacgggttctcatactggcatctggttctatgaagaggcacggc
tttctaagcgaggccgaggactacgttagggaagccggagcagaggttatgagtatatca
ggacttccggcggagccgagcgttgaggtcattgaggagttcctgccgaaggttagggag
tttgggcccgatctcctcatagccatgggcggcggcagcgttatcgacacgaccaaagcc
ctcaaggtcttctacgatgcccccgagctcgtctttgaggagatagccttcatcaaccgt
ttctcaaggccgaagcccgttccaaaactaaaaactcccctcatcgcgattccctcaacg
agcggagctggaagcgaggtttccgcggccagtgtcctgaagaagaacgggataaagtac
aacatcgtaacgccggagatagcacctgaggtagctattctcgacccgaggctcccgagg
actatgccaagggaagttgcgaggaattctggcctggatgtcctcgtccacggtatagag
gcttacacaactaaggtcgctgggcccttcagcgatgcgatggcgataagggcgataaag
accgtcttcgagtggcttccgaagtcggttgaaggtgaccccgaggcgagggcaagaatg
cactacgcggcaacgatggcagggatagcctttctcaatgccaggcttggtttggcccac
gcgatgagccacaaggcggcatgggtaggtccccatggcttactcaacgcgatattcata
ccctacgtgatggagttcaacgccgagaggagtgagtatgcgaggaagcgctatgctgag
atagcgcgcgaacttgggttgaagagtgctgaagagctgataaaagccgtcagagagctc
aacgagcgccttggagttccaaagctaagcgagcttgttgatgaagagacttttgttgaa
agggttgaggagatggctgaaaaggcctaccgcgacgggctgatagcgttcaaccccgtt
gaaccaaagccagaggagataagagagctttatctgaaggctttgaacgcgttatag

DBGET integrated database retrieval system