KEGG   Thermococcus kodakarensis: TK1177Help
Entry
TK1177            CDS       T00226                                 

Definition
(GenBank) deblocking aminopeptidase
  KO
K20608  
tetrahedral aminopeptidase [EC:3.4.11.-]
Organism
tko  Thermococcus kodakarensis
Brite
Enzymes [BR:tko01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     TK1177
Peptidases [BR:tko01002]
 Metallo Peptidases
  Family M42: glutamyl aminopeptidase family
   TK1177
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1034403..1035443
Genome map
AA seq 346 aa AA seqDB search
MVDIELLKRVVEAPGVSGFEFLGIRDVVIEALKDYVDEIKVDKLGNVIAHKKGNGPKVMV
AAHMDKIGLMVNHIDNEGYLHVVPIGGVDPRTLVAQRIRFFTDKGERYGVVGHIPPHLQK
PEDRKKAADWDTIVVDVGADSKEEAEEMGFRVGTVGEFAPAFTKLTENRIATPYLDDRVC
LYAMIEAARALENHEADIYFVASVQEEVGLRGARVASYAIDPEIGIAMDVTFAKQVGDKG
KIVPKLGGGPVMDEVGPNIHPKVRRFADEVAKKYDIPLQVEASPRPTGTDANIMQINREG
VATAVLSIPIRYMHSQVETADLRDIDLTIKFAKHFLEELRPMDLTP
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggttgacatagagttgctcaagagggttgttgaagcccctggcgtttctggatttgag
ttcctcggcataagggacgtcgtaatagaggcactgaaggactacgtggacgagataaag
gtcgacaagctcggcaacgtcatagcccacaagaaggggaacgggccaaaggtcatggta
gcggcccatatggacaagatcggcctcatggtaaaccacattgacaatgaaggctacctc
cacgtcgtcccgatagggggagttgacccgaggacgctcgtggcccagaggataaggttc
ttcaccgacaagggcgagcgctacggtgtcgtcggacacatcccaccccacctccagaag
cctgaggacagaaagaaggccgccgactgggacaccatagtggttgatgtcggtgcagac
agcaaggaagaggcagaggaaatgggcttccgcgttggaaccgtcggcgagttcgcacca
gccttcaccaagctcaccgagaacaggatagccaccccctaccttgacgaccgcgtctgc
ctctacgccatgatcgaggctgccagggcacttgagaaccacgaggcggacatatacttc
gtcgcatcagtccaggaggaggtcgggctgaggggagcgcgcgtcgctagctacgcaata
gacccggagatcggcatagcgatggacgtaaccttcgccaagcaggtcggcgacaagggc
aagatcgttccaaagctcggcggcgggccagttatggacgaggtcggccccaacatccac
cccaaggtcaggcgcttcgccgatgaagtcgccaagaagtacgacatcccgctccaggtc
gaggcaagcccgaggccgacgggaaccgacgccaacataatgcagatcaacagggagggc
gtggcaactgcagttctcagcataccgataaggtacatgcacagccaggtcgaaacggcc
gacctcagggacatcgaccttaccataaagttcgccaagcacttcctcgaggagctcagg
ccgatggacctaaccccatga

DBGET integrated database retrieval system