KEGG   Thermococcus kodakarensis: TK1442Help
Entry
TK1442            CDS       T00226                                 

Definition
(GenBank) tryptophan synthase beta subunit-related protein
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
tko  Thermococcus kodakarensis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tko00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TK1442
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TK1442
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TK1442
Enzymes [BR:tko01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     TK1442
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1266691..1268019
Genome map
AA seq 442 aa AA seqDB search
MKAVLPDSKIPKRWYNILPDLPEPLAPPLDPETDEPMEPEKLLRIFAEELVKQEMSTDRY
IEIPKEVREIYSKIGRPTPLFRATNLERALGTPARIYFKYEGATVTGSHKINTALAQAYY
AKRQGIERLVTETGAGQWGTALSLAGALLGLNVRVYMARASYQQKPYRKTIMRLYGAEIY
PSPSDRTEIGRKFLAEDPNHPGGLGIAISEAIEDVLRDEKARYALGSVLNHVLMHQTVIG
LEAQEQMKEFEEPDVIIGCVGGGSNFAGLAYPFVRDVLKGEAEYEFIAVEPKAAPSMTRG
VYKYDYGDSGGYTPKMKMHTLGHTYYVPPIHAGGLRYHGLAPTLSVLINHGIVKPVAYHQ
NEVFQAAHLFAKTEGIVPAPESAHAIKGAIDRALEAKREGREEVILFNLSGHGFLDLKGY
EDYLDGKLEDYEPEHFPALDNY
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccgttctgcccgattcgaagataccaaagaggtggtacaacatcctgcccgac
ctccctgaaccgctggcgccaccgctcgaccccgagacagacgagcctatggagccggag
aagctcctaaggattttcgcggaggagctggtgaaacaggaaatgagcacggataggtac
attgaaatcccgaaagaagtcagagagatctactccaaaataggccgcccaacccctctc
ttccgcgccacaaaccttgagagagccctcggcactccagcgaggatatacttcaagtat
gagggggcaacggtaacgggaagccacaagataaacaccgccctagctcaggcttactac
gccaagaggcagggaatagaaaggctcgtaaccgagactggagcaggccagtggggaact
gccctaagcctcgccggggcacttcttggtctcaatgtaagggtgtacatggcgagggcg
agctaccagcagaagccctacaggaagaccataatgcgcttgtatggtgctgaaatctat
ccgagtccaagcgatagaacagagataggcagaaagttcctggccgaggatccaaaccac
cccggaggtctcggtatagcgataagcgaggccatcgaagacgttttaagggacgaaaag
gcccgctacgccctgggaagcgtcctcaaccacgtcctcatgcaccagaccgtcataggt
cttgaggcccaggagcagatgaaggagttcgaagagcccgacgttataatcggctgtgta
ggcggaggaagcaacttcgcaggcttggcttatccgttcgtcagagacgttctgaaagga
gaggctgaatatgagttcatagcggttgagcctaaggccgctccctcgatgacgagggga
gtttacaagtacgactacggtgattccggaggatacacgccgaaaatgaagatgcacacc
ctcggccacacatactacgtcccgccgattcacgctggcggcctgcgctatcacggactt
gctccgactctcagcgtcctgataaaccacgggatagttaagcccgttgcctaccaccag
aacgaggtcttccaggcggctcacctcttcgcgaagactgaggggatagttccagctcca
gagagcgcccacgccatcaaaggggccatagaccgcgccctggaggcaaagcgggaagga
cgtgaagaggtcatactcttcaacctcagcgggcacggcttcctcgaccttaagggctac
gaggactatctggatggaaagcttgaggactacgagccggagcacttcccggccctggat
aactactga

DBGET integrated database retrieval system