KEGG   Thermococcus kodakarensis: TK1650Help
Entry
TK1650            CDS       T00226                                 

Definition
nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
tko  Thermococcus kodakarensis
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tko00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    TK1650
Enzymes [BR:tko01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     TK1650
    3.5.1.-  
     TK1650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1447574..1448110)
Genome map
AA seq 178 aa AA seqDB search
MPKEALIVVDMQRDFMPGGALPVPEGDTIIPKCNEYIKKFKEKGALIVATRDWHPPNHIS
FKERGGPWPPHCVQNTPGAEFVVDLPEDAIIISKATEPDKEAYSGFEGTNLAEILRENGV
EKVYICGVATEYCVKATALDAVRHGFETYLLSDAVKGINPEDEKKALEEMKRAGVKIL
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgccgaaggaggccctcatagttgttgatatgcagcgcgacttcatgcccgggggggcg
ctcccagtaccggagggcgacaccatcattcccaaatgcaacgagtacatcaaaaagttc
aaggagaagggtgctctcatagtggccacgagggactggcatcccccgaaccacatcagc
tttaaggagaggggcgggccgtggccgccacactgcgttcagaacactcctggagcggag
ttcgttgtggacctgccagaggacgccataataatctcaaaggcgaccgaacctgataag
gaggcctactcgggctttgaaggtacgaacctcgcggagattctcagggagaacggcgtt
gagaaggtttacatctgcggtgttgccactgagtactgtgtgaaggcgacagccctcgac
gcggtcaggcacggctttgagacctacctcctgagcgatgcagttaagggcatcaacccc
gaggacgagaagaaggcccttgaggagatgaagagagctggtgtgaagattctgtga

DBGET integrated database retrieval system