KEGG   Thermococcus kodakarensis: TK1761Help
Entry
TK1761            CDS       T00226                                 

Definition
beta-galactosidase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
tko  Thermococcus kodakarensis
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tko00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    TK1761
  Lipid metabolism
   00600 Sphingolipid metabolism
    TK1761
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    TK1761
Enzymes [BR:tko01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     TK1761
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1562308..1563762
Genome map
AA seq 484 aa AA seqDB search
MREFAWGVVQSAFQFEMGDPLRRFIDTRTDWWHWVRDPLNIKNDLVSGHLPEDGINNYGL
YEIDHQLAKDMGLNAYQITVEWSRIFPCPTYGVEVDFERDSYGLIKRVKITKETLHELEE
IANAKEVEHYREVLKNLKELGFSTFVTLNHQTQPIWLHDPIHVRENFEKARAKGWVDERA
ILEFAKFAAFVAWKLGDLVDFWATFDEPMVTVELGYLAPYVGWPPGILNPKAAKAVIINQ
LVGHARAYEAVKTFSDKPVGIILNIIPAYPRDPNDPKDVKATENYDLFHNRIFLDGVNEG
KVDLDFDGNYVKIDHLKRNDWIGNNYYTREVIRYTEPKYEELPIINFVGTEGYGYSSEPN
SVSKDNNPTSDFGWECFPQGMYDSIMIGNEYRKPIYITENGIADSRDLLRPRYIKEHVEK
MFEAIQAGADVRGYFHWALTDNYEWAMGFKIKFGLYEVDPISKQRIPRPRSVETYKKIVR
EGLP
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgagggagtttgcatggggcgttgtccagtcggcgtttcagtttgagatgggagatcca
ttgaggaggtttatagacactcggacggactggtggcactgggtccgcgatccgctcaac
ataaagaacgacctcgtgagcgggcacctgcccgaggacggcataaacaactacggcctc
tatgagatagaccatcagcttgcaaaggatatgggactgaacgcctatcagataacggtt
gagtggagcagaatctttccgtgtccgacttatggagttgaagtggacttcgagagggac
tcatacggactcataaaaagagtgaagatcacaaaggaaaccctccacgagcttgaggaa
atcgcgaacgcaaaggaagtcgagcactacagagaggttctcaaaaacctaaaggaactc
ggcttttcaactttcgtaaccctaaaccaccagacgcagccgatatggctccacgatcca
atccatgtgagggaaaactttgaaaaagcaagggctaagggatgggtcgacgagagggcc
atccttgagttcgccaagttcgccgcttttgttgcctggaagcttggggatctagtcgac
ttctgggcaaccttcgacgagccaatggttacggttgagcttggctacctcgctccctac
gtcggatggccgccggggatacttaacccgaaggcagctaaagcagttatcatcaaccag
ctcgttggacacgcaagggcctacgaggcagttaaaaccttctcagacaagcccgtcgga
ataatactcaacataatccccgcttacccccgcgaccccaacgaccctaaggacgttaag
gcaacggagaactacgatctcttccacaacaggatattcctcgatggagtcaacgaaggg
aaggttgatcttgatttcgatgggaactatgtcaaaatcgatcacttgaagagaaacgac
tggatcggcaacaactactacaccagggaggtcattaggtacacggaacccaaatacgag
gagctcccgataataaacttcgtggggaccgaagggtacggttactcctcggagcctaac
agcgtctcgaaggacaacaaccccacgagcgactttggctgggagtgcttcccgcaagga
atgtacgattcgataatgataggaaacgaatacaggaagccgatatacataacggagaac
ggcatagccgattcgagagatctcctaaggccgagatatataaaggagcatgtggagaag
atgttcgaagcaattcaggctggggccgatgtgaggggatacttccactgggccctgacc
gacaactacgagtgggcaatgggttttaaaatcaagttcggcctctatgaggttgatcca
ataagcaagcagagaataccccgccccagaagcgtggaaacatacaaaaagatagtgcgg
gagggattaccttga

  All links  
No link information was found.   
DBGET integrated database retrieval system