KEGG   Thermococcus kodakarensis: TK1982Help
Entry
TK1982            CDS       T00226                                 

Definition
(GenBank) pyruvate:ferredoxin oxidoreductase, delta subunit
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
tko  Thermococcus kodakarensis
Pathway
tko00010  Glycolysis / Gluconeogenesis
tko00020  Citrate cycle (TCA cycle)
tko00620  Pyruvate metabolism
tko00640  Propanoate metabolism
tko00650  Butanoate metabolism
tko00680  Methane metabolism
tko00720  Carbon fixation pathways in prokaryotes
tko01100  Metabolic pathways
tko01120  Microbial metabolism in diverse environments
tko01130  Biosynthesis of antibiotics
tko01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tko00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TK1982
   00020 Citrate cycle (TCA cycle)
    TK1982
   00620 Pyruvate metabolism
    TK1982
   00640 Propanoate metabolism
    TK1982
   00650 Butanoate metabolism
    TK1982
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    TK1982
   00680 Methane metabolism
    TK1982
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    TK1982
Enzymes [BR:tko01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     TK1982
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_6 Fer4_21 Fer4_2 Fer4_7 Fer4_10 Fer4_16 Fer4_9 Fer4_8 Fer4_4 Fer4_22 Fer4_15 Fer4_17 Fer4_13
Motif
Other DBs
NCBI-ProteinID: BAD86171
UniProt: Q5JIJ8
Position
1786520..1786837
Genome map
AA seq 105 aa AA seqDB search
MAESPFKADIERVQKEYSEKMTPGAIAYIPGSSVINKTGSWRVFMPEFNRDKCTRCYLCY
IYCPEPAIYLDEEGYPVFDYDYCKGCGICANECPVDAIVMVRETK
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atggctgagagtccgtttaaggccgatattgagagggttcagaaggagtacagcgaaaag
atgacgcccggagcgatagcttacatcccgggaagcagcgttatcaacaagacaggttcc
tggagagtttttatgcctgaattcaaccgcgacaagtgcactcgctgctacctctgctat
atctactgcccggagccggctatctacctcgatgaggaaggctacccggtctttgactac
gactactgtaagggctgtggcatctgcgccaacgaatgccctgttgatgccatagttatg
gttagggagaccaagtga

DBGET integrated database retrieval system