KEGG   Thermococcus kodakarensis: TK1982Help
Entry
TK1982            CDS       T00226                                 

Gene name
porD
Definition
pyuvate ferredoxin oxidoreductase subunit delta (EC:1.2.7.1)
Orthology
K00171  
pyruvate ferredoxin oxidoreductase, delta subunit [EC:1.2.7.1]
Organism
tko  Thermococcus kodakarensis
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tko00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TK1982 (porD)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TK1982 (porD)
   00020 Citrate cycle (TCA cycle)
    TK1982 (porD)
   00620 Pyruvate metabolism
    TK1982 (porD)
   00640 Propanoate metabolism
    TK1982 (porD)
   00650 Butanoate metabolism
    TK1982 (porD)
  Energy metabolism
   00680 Methane metabolism
    TK1982 (porD)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    TK1982 (porD)
Enzymes [BR:tko01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     TK1982 (porD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1786520..1786837
Genome map
AA seq 105 aa AA seqDB search
MAESPFKADIERVQKEYSEKMTPGAIAYIPGSSVINKTGSWRVFMPEFNRDKCTRCYLCY
IYCPEPAIYLDEEGYPVFDYDYCKGCGICANECPVDAIVMVRETK
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atggctgagagtccgtttaaggccgatattgagagggttcagaaggagtacagcgaaaag
atgacgcccggagcgatagcttacatcccgggaagcagcgttatcaacaagacaggttcc
tggagagtttttatgcctgaattcaaccgcgacaagtgcactcgctgctacctctgctat
atctactgcccggagccggctatctacctcgatgaggaaggctacccggtctttgactac
gactactgtaagggctgtggcatctgcgccaacgaatgccctgttgatgccatagttatg
gttagggagaccaagtga

DBGET integrated database retrieval system