KEGG   Thermococcus kodakarensis: TK2129Help
Entry
TK2129            CDS       T00226                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tko  Thermococcus kodakarensis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:tko01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:tko01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:tko00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:tko00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:tko00562]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1909411..1910091
Genome map
AA seq 226 aa AA seqDB search
MAKLKEPIIAINFKTYIEATGKRALEIAKAAERVWKETGITIVVAPQLADLRMIAESVEI
PVFAQHIDPIKPGSHTGHVLPEAVKEVGAVGTLLNHSENRMILADLEAAIRRAEEVGLMT
MVCSNNPAVSAAVAALGPDYVAVEPPELIGTGIPVSKAKPEVVTNTVELVKKVNPDVGVL
TGAGISTGEDVKKALELGSVGVLLASGVTKAKDPENAIRDLVSLII
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagctaaaggagccgattatagcgataaacttcaagacctacatcgaggcaaca
ggaaagagggctctggagatagcgaaggcggctgagagagtctggaaggagacgggcata
acgatcgtcgtcgccccccagctggccgacctgaggatgatagctgagagtgttgaaatc
ccagtctttgcacagcacattgacccgataaagcctggaagccacaccggccacgttctt
ccagaggccgttaaggaagtcggggctgtcggaacgctcctcaaccactcggagaacagg
atgattttggccgaccttgaagcggcgataagaagagctgaagaagtcgggctgatgaca
atggtctgctccaacaacccggcggtttcagcggcggtcgctgcccttggcccggactac
gttgccgttgagccgccagagctaatagggaccggaatcccggtcagtaaggcaaagccc
gaggtagtcacgaacaccgtcgagctcgtgaaaaaggtaaaccctgacgttggagtccta
actggagctggcatctccacgggagaagacgtcaagaaggcactcgaactcggaagcgtt
ggggttctcctcgcgagcggcgtcacgaaggccaaagacccagagaatgcgataagggac
ctcgtgtcacttatcatttga

DBGET integrated database retrieval system