KEGG   Thermococcus kodakarensis: TK2129Help
Entry
TK2129            CDS       T00226                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tko  Thermococcus kodakarensis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:tko00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TK2129
   01230 Biosynthesis of amino acids
    TK2129
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TK2129
   00051 Fructose and mannose metabolism
    TK2129
   00562 Inositol phosphate metabolism
    TK2129
Enzymes [BR:tko01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     TK2129
Exosome [BR:tko04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   TK2129
  Exosomal proteins of bladder cancer cells
   TK2129
  Exosomal proteins of melanoma cells
   TK2129
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1909411..1910091
Genome map
AA seq 226 aa AA seqDB search
MAKLKEPIIAINFKTYIEATGKRALEIAKAAERVWKETGITIVVAPQLADLRMIAESVEI
PVFAQHIDPIKPGSHTGHVLPEAVKEVGAVGTLLNHSENRMILADLEAAIRRAEEVGLMT
MVCSNNPAVSAAVAALGPDYVAVEPPELIGTGIPVSKAKPEVVTNTVELVKKVNPDVGVL
TGAGISTGEDVKKALELGSVGVLLASGVTKAKDPENAIRDLVSLII
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagctaaaggagccgattatagcgataaacttcaagacctacatcgaggcaaca
ggaaagagggctctggagatagcgaaggcggctgagagagtctggaaggagacgggcata
acgatcgtcgtcgccccccagctggccgacctgaggatgatagctgagagtgttgaaatc
ccagtctttgcacagcacattgacccgataaagcctggaagccacaccggccacgttctt
ccagaggccgttaaggaagtcggggctgtcggaacgctcctcaaccactcggagaacagg
atgattttggccgaccttgaagcggcgataagaagagctgaagaagtcgggctgatgaca
atggtctgctccaacaacccggcggtttcagcggcggtcgctgcccttggcccggactac
gttgccgttgagccgccagagctaatagggaccggaatcccggtcagtaaggcaaagccc
gaggtagtcacgaacaccgtcgagctcgtgaaaaaggtaaaccctgacgttggagtccta
actggagctggcatctccacgggagaagacgtcaagaaggcactcgaactcggaagcgtt
ggggttctcctcgcgagcggcgtcacgaaggccaaagacccagagaatgcgataagggac
ctcgtgtcacttatcatttga

DBGET integrated database retrieval system