KEGG   Thermococcus kodakarensis: TK2132Help
Entry
TK2132            CDS       T00226                                 

Definition
L-fuculose phosphate aldolase (EC:4.1.2.17)
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
tko  Thermococcus kodakarensis
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:tko00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1912285..1912839)
Genome map
AA seq 184 aa AA seqDB search
MRTAKAQLVKYSRKAHERGLTAAFGGNLSIRVGDLVFIKATGSVMDEMTPEQVAVVALDG
RQISGVKPSSEYRLHLAVYRERPDVKAIAHLHPPYSIVASALLTGELPILTPEAEIYLGK
IPIAPFRPAGTEELAEVVAEKIREADAVLMERHGIVTVGRSLREAFYKAELVEESAKLWY
LSRK
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgagaactgcaaaagcccagcttgtgaagtactccagaaaagcccacgagaggggcctg
actgcggcattcggtggaaacttgagcataagagttggggatctggtcttcatcaaggcc
accggctccgtgatggacgagatgactccggagcaggtcgctgtagttgccctcgacgga
agacagataagcggcgttaaaccctcttcagaataccgcctgcaccttgcagtctaccgg
gaaagacccgacgttaaggccatcgcccacctgcacccgccgtactcgatagttgcttcc
gcactgctcactggagagctcccaatactcactccagaggccgagatataccttggtaag
attccgatagcacctttcagaccggccggaaccgaagaactggcagaagttgtggctgaa
aaaatcagggaagcggacgcggttcttatggagaggcacgggattgtgaccgttggaaga
agccttagagaagcgttctacaaggctgaactcgtggaagaaagcgcaaagctgtggtat
ctgagcaggaaatga

DBGET integrated database retrieval system