KEGG   Thermococcus kodakarensis: TK2163Help
Entry
TK2163            CDS       T00226                                 

Definition
tungsten-containing glyceraldehyde-3-phosphate:ferredoxin oxidoreductase
Orthology
K11389  
glyceraldehyde-3-phosphate dehydrogenase (ferredoxin) [EC:1.2.7.6]
Organism
tko  Thermococcus kodakarensis
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:tko01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:tko01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:tko00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1941983..1943941)
Genome map
AA seq 652 aa AA seqDB search
MKFTVLHLKLDERKVESEEFEKEGVYGIIDYGLELHERLGTHSIEPYDPKNVVVMGMGPF
SGSILPGAHRLMFFFRSPLYGTLFPSAMGGAAYAFKNVGVDFVTFEGKAEKPVVVILYND
GSNINVELHEIELEKLIEIWKDYKGEEGVYALTQYLIDTFGERFDFEYRIAVVGPAALNS
NYGAIFSQTLRKGKRVEGSEDWAARGGSGSVLLRAHNVVGIIFGGKPRKREFPGEDISSF
RTAKEIVEGVHKKPYNDVIAEKTVKYKYNPKLKTGGTFGGNYPAEGDFVPILNWQMPYIP
KEERIKIHEAIMKYYWEPFNKEAIETKNWTNCGEPCPVVCKKYANGHHIEYEPREANGPL
SGVITLRASDISVPAVDAMGFDAIEFGGTAAWVLELVHRGILKPEEVGLSDVPDFTKEAL
LERPVEASEKNAKLVAELAHRVAFAENEIAKILGLGKRKASVILDEKFKDRLKYGESFKD
YAVFTPLGEDGEMTPTMYWAIGNYIPLPIQGRYWTFYQFGVFLEPEELAQKIIASALWEF
WYDNVGWCRFHRGWMKPVLKALFMEAYGENVDMEEHAKKQIKRLIEFAREAGYTPVFWDS
MRVIDLVARGSEEFGNEKWAEKFKIDKVGTAREYLEKVLDTYSEMLGVEWRL
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgaagttcacggtgcttcacctgaagcttgacgagaggaaagttgagagcgaggagttc
gaaaaagagggagtttacggcatcatagactacggcctcgaactccatgagaggcttgga
actcactcaattgaaccgtatgatccgaagaacgttgtcgtaatggggatggggccgttc
tcgggttcaatactgcccggtgcccacaggcttatgttcttcttccgctcgccgctctac
gggacgctcttcccgtcggcgatgggcggtgccgcctacgccttcaagaacgtcggcgtt
gacttcgtcacatttgaagggaaggctgagaagccggttgttgtcatcctctacaacgac
ggctcgaacatcaacgtcgagctccacgagatagagctcgaaaagctgatcgagatctgg
aaggactataagggcgaggagggcgtctacgcgctcacccagtacctcatagacaccttc
ggcgagaggttcgacttcgagtaccgcatcgccgtcgtgggtcctgcagccctcaactcc
aactacggtgccatcttctcccagaccctaaggaagggcaagcgcgttgagggaagcgag
gactgggcggcaaggggtggctctggaagcgtcctcctcagggcccacaacgtagtcggt
ataatcttcggtggaaagccgaggaagagggaattcccgggcgaggatatctcgtcattc
agaaccgccaaagagatcgttgaaggcgtccacaagaagccctacaacgacgtcatagct
gagaagaccgtcaagtacaagtacaaccccaagctcaagacaggaggaactttcggtggg
aactacccggcggagggcgacttcgtcccgattctcaactggcagatgccctacatcccg
aaagaagagaggatcaagatccacgaggcaataatgaagtactactgggagcccttcaac
aaggaggcgatagagaccaagaactggacgaactgcggtgagccgtgcccggtcgtgtgc
aagaagtacgccaacggtcaccacatcgagtacgagccgagggaggccaacggcccgctc
agcggcgttataaccctccgcgccagtgacataagcgttccggccgttgatgcgatgggc
ttcgacgccatagagttcggcggaacagctgcgtgggttctcgagctcgtccaccgcgga
atactcaagcctgaggaagtcggcctcagcgatgtcccagacttcacgaaagaggccctc
cttgagaggcccgtcgaggccagcgagaagaacgccaagctcgtcgctgaactggcccac
cgcgtcgccttcgccgagaacgagatagccaagatactcggcctcgggaagagaaaagca
agcgtaatcctcgacgagaagttcaaggacaggctaaagtatggcgagagcttcaaggac
tacgctgtgtttacccccctcggcgaggacggcgagatgacgccgacgatgtactgggcc
atcggaaactacatcccgctcccgattcaggggaggtactggacgttctaccagttcgga
gtcttcctagagcccgaggagcttgcccagaagattatcgccagcgccctatgggagttc
tggtacgacaacgtcggctggtgccgcttccaccgcggctggatgaagccagtacttaag
gctctcttcatggaggcctacggtgagaacgttgacatggaggagcatgctaagaaacag
ataaagcgccttatagagttcgcgagggaggctggctatactccagtgttctgggacagc
atgcgcgtcatcgacctcgttgccaggggaagtgaagagttcggcaacgaaaagtgggcc
gagaagttcaagatcgacaaggtcggaacggccagggagtaccttgagaaggtgctcgat
acgtacagcgagatgcttggggtcgagtggaggctttaa

DBGET integrated database retrieval system