KEGG   Thermococcus kodakarensis: TK2164Help
Entry
TK2164            CDS       T00226                                 

Definition
fructose-1,6-bisphosphatase
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
tko  Thermococcus kodakarensis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tko00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TK2164
   01230 Biosynthesis of amino acids
    TK2164
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TK2164
   00030 Pentose phosphate pathway
    TK2164
   00051 Fructose and mannose metabolism
    TK2164
  Energy metabolism
   00680 Methane metabolism
    TK2164
Enzymes [BR:tko01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     TK2164
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     TK2164
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1944094..1945221)
Genome map
AA seq 375 aa AA seqDB search
MAVGDKITISVIKADIGGWPGHSRVHPQLVETAEDVLSKAVEDGTIIDFYVATCGDDLQL
IMTHKRGVDSPDIHGLAWKAFEEATKVAKELGLYGAGQDLLKDAFSGNVRGMGPGVAEME
ITLRKSEPVVTFHMDKTEPGAFNLPIFRMFADPFNTAGLIIDPKMHMGFRFEVWDILEHK
RVILNTPEELYDLLALIGAKSRYVIKRVYPKPGHPIPENEPVAVVSTEKLYEVAGEYVGK
DDPVAIVRAQSGLPALGEVLEPFAFPHLVSGWMRGSHNGPLMPVPMHQANPTRFDGPPRV
VALGWQISPEGKLVGPVDLFDDPAFDYARQKALEITEYMRRHGPFEPHRLPLEEMEYTTL
PGVLKRLTDRFEPIE
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggccgttggagataagatcaccatcagcgttatcaaagcggatataggcggctggcct
ggacactcaagggttcacccgcagctcgttgagacagccgaggatgttctttcaaaagca
gtcgaagatggcactataatagacttttacgttgcaacctgcggcgatgatttacagctc
atcatgacccacaagaggggcgttgacagtccagacatacatggccttgcatggaaggcc
ttcgaagaggccaccaaggtcgcaaaggaactcggtctctacggagctggccaggacctc
ctcaaggatgccttcagcggcaacgtccgcggaatgggaccaggagttgccgagatggaa
ataaccctcaggaagagcgagcctgtagttacattccacatggacaagacagagcccgga
gccttcaacctcccgatattcaggatgttcgcagacccgttcaacaccgcgggcctcatc
atcgacccgaagatgcacatgggcttccgctttgaggtctgggacatcctcgagcacaag
agggtcattcttaacactccagaagagctctacgaccttctggccctcataggtgcaaag
agccgctacgtcatcaagagggtctatccgaagcctgggcacccaatccctgagaacgag
ccggtcgctgttgtcagcaccgagaagctatacgaagtagccggagagtacgtcggaaag
gacgacccagttgccatcgtcagagcccagagcggtctacccgccctcggtgaggtcctc
gagcccttcgccttcccgcacctcgtcagcggctggatgaggggttcccacaacggccca
ctaatgccggtcccgatgcaccaggccaacccgaccaggttcgacggcccgccgagggtt
gtcgctctcggctggcagataagcccagaaggaaagctagtcggcccagttgacctcttt
gacgaccctgccttcgactatgcccgccagaaggcccttgagataaccgaatacatgcgc
aggcacggacccttcgaaccgcacaggctcccgctagaggagatggagtacactaccctt
ccgggagttctcaagaggctcaccgacaggttcgagcctatcgagtga

DBGET integrated database retrieval system