KEGG   Thermotoga lettingae: Tlet_0060Help
Entry
Tlet_0060         CDS       T00618                                 

Definition
transketolase
Orthology
K00615  
transketolase [EC:2.2.1.1]
Organism
tle  Thermotoga lettingae
Pathway
Pentose phosphate pathway
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:tle00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tlet_0060
   01230 Biosynthesis of amino acids
    Tlet_0060
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Tlet_0060
  Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    Tlet_0060
Enzymes [BR:tle01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     Tlet_0060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(64811..66700)
Genome map
AA seq 629 aa AA seqDB search
MKTFNKHDIKKLKQIARLCRGDILKMTYVANSGHPGGSMSSLEIFLSVFSFANLNPDNPY
DPLRDRVVVSHGHTSPGVYSVLGRLGFVDIDQVIAGFRHHSSIFEGHVTRGIPGVEWTTG
NLGQGLSAGVGFALAAKMKEQDYHIFVAMSDAEQAKGQVAEARRVAKKYGLSNLTVVIDY
NDAQISGRARDVMPVNIRKNYEADGWRVLEVDGHDIEQLLHALSQAVEDKVNPVAILAHT
IMGKGVSFMENDVSYHGKPLDKEQLEKALNELGIDNDVEKYMKMRAQLGNQKHEPFHLEY
PVKIKVPAGRTYTTKTDNRSAFGNALLDLVKENRNSETPVVAVDCDLATSVKLDGVQKYV
PERFLELGVQEHNAAAVAGALSADGVVTFFADFGVFGVSETYNQHRLNAINHTNLKVIVT
HCGLNVGEDGKTHHGLDYISAPANWLGYKVIVPADPNQTDRVIRYIASVYGNYLVAMGRA
KMMPIVDENGKLFFADNYRFEYGKIDILRKGTDVTVVTCGSVVPNVVEAADKLRGKVSVL
NVSCPLDLDEHVLREYGHGKKILVVEDHVATLGLTSLLAKFFLQKGIIPSSFEQIAIQEH
AVSGSYEALYEIYGLSSTKIAEKLGQMIS
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atgaagacatttaataagcatgatatcaaaaaactcaaacagatagcacgcctttgccgc
ggtgatatacttaaaatgacatatgtagctaattcaggtcatccgggaggatcgatgtcc
tctctggagatttttttaagtgttttttcatttgcaaatcttaatcctgataatccttat
gaccccttgagagatcgtgttgtagttagccatggccacacatcaccaggggtatattca
gttctgggcaggctcggatttgtagacatagatcaggttatagctggtttcagacaccat
tcgagtatctttgaaggacatgtaacccgtggcattcctggtgtcgaatggactacagga
aatctgggacagggcttgtcagctggagtgggatttgcattggccgctaaaatgaaggag
caggattaccatatttttgtggcaatgagcgatgcggaacaggcaaaaggacaggtagct
gaagctcgccgggttgcaaaaaaatacgggttgagtaatctgactgttgttatagattac
aatgatgcccagatttctggaagagcaagagacgtaatgccggttaatatcagaaaaaac
tacgaagcagatgggtggagagttctggaagttgatggtcatgatatagaacagcttttg
catgcactttcacaggctgttgaagataaagtcaatcctgttgctatactggcacacact
attatgggcaaaggtgtgtcgttcatggaaaatgatgtttcttatcatgggaaacctctc
gataaagaacaacttgagaaagctctgaatgaacttggcattgataacgatgtggagaaa
tatatgaagatgcgtgctcagcttggtaatcagaaacatgaaccattccatctggagtat
cctgtaaaaataaaagttccagctggcagaacttacacaaccaaaactgataatcggagt
gcttttggaaatgctttattggatttagtaaaagagaacaggaactctgaaacacctgta
gtagctgtagattgcgaccttgcaacatctgtaaagcttgacggggttcagaagtacgtt
ccagaaagatttttagagcttggtgttcaggaacataatgcggcagctgttgcaggagca
ctttctgcagatggtgtggtgaccttttttgctgattttggagtgtttggagtaagtgag
acgtataatcagcacagattgaatgctataaaccacaccaatttgaaagttattgtgact
cattgcggtttaaatgtaggggaggacggaaaaactcaccatggacttgattacatctct
gcacctgcaaattggctgggttacaaagttatcgtaccggcagatcccaatcaaaccgac
agggttattcgctacattgcatcggtatatggaaactacctggtagccatgggcagggca
aaaatgatgcctatcgttgatgaaaatggcaagttgttttttgcggataactatcgtttt
gaatatggaaagatagatattctcagaaaaggaacagatgtgactgttgtgacatgtgga
tctgttgtgccaaatgttgtcgaggctgcggataaattgagaggtaaggtaagcgttctg
aatgtgtcatgcccgcttgatcttgacgagcatgtgttgagagaatatggacacgggaag
aaaatcttggttgttgaggatcatgttgcgacacttggattaacatctcttctggcaaaa
tttttcttgcagaaagggataattccttcaagttttgaacaaattgctattcaagagcat
gcagtttcaggatcttacgaggctctatatgaaatctatggactcagctctactaagatt
gccgaaaagctgggtcagatgatcagttga

DBGET integrated database retrieval system