KEGG   Thermotoga lettingae: Tlet_0060Help
Entry
Tlet_0060         CDS       T00618                                 

Definition
transketolase
Orthology
K00615  
transketolase [EC:2.2.1.1]
Organism
tle  Thermotoga lettingae
Pathway
Pentose phosphate pathway
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Class
Metabolism; Overview; Carbon metabolism [PATH:tle01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:tle01230]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:tle00030]
Metabolism; Metabolism of terpenoids and polyketides; Biosynthesis of ansamycins
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(64811..66700)
Genome map
AA seq 629 aa AA seqDB search
MKTFNKHDIKKLKQIARLCRGDILKMTYVANSGHPGGSMSSLEIFLSVFSFANLNPDNPY
DPLRDRVVVSHGHTSPGVYSVLGRLGFVDIDQVIAGFRHHSSIFEGHVTRGIPGVEWTTG
NLGQGLSAGVGFALAAKMKEQDYHIFVAMSDAEQAKGQVAEARRVAKKYGLSNLTVVIDY
NDAQISGRARDVMPVNIRKNYEADGWRVLEVDGHDIEQLLHALSQAVEDKVNPVAILAHT
IMGKGVSFMENDVSYHGKPLDKEQLEKALNELGIDNDVEKYMKMRAQLGNQKHEPFHLEY
PVKIKVPAGRTYTTKTDNRSAFGNALLDLVKENRNSETPVVAVDCDLATSVKLDGVQKYV
PERFLELGVQEHNAAAVAGALSADGVVTFFADFGVFGVSETYNQHRLNAINHTNLKVIVT
HCGLNVGEDGKTHHGLDYISAPANWLGYKVIVPADPNQTDRVIRYIASVYGNYLVAMGRA
KMMPIVDENGKLFFADNYRFEYGKIDILRKGTDVTVVTCGSVVPNVVEAADKLRGKVSVL
NVSCPLDLDEHVLREYGHGKKILVVEDHVATLGLTSLLAKFFLQKGIIPSSFEQIAIQEH
AVSGSYEALYEIYGLSSTKIAEKLGQMIS
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atgaagacatttaataagcatgatatcaaaaaactcaaacagatagcacgcctttgccgc
ggtgatatacttaaaatgacatatgtagctaattcaggtcatccgggaggatcgatgtcc
tctctggagatttttttaagtgttttttcatttgcaaatcttaatcctgataatccttat
gaccccttgagagatcgtgttgtagttagccatggccacacatcaccaggggtatattca
gttctgggcaggctcggatttgtagacatagatcaggttatagctggtttcagacaccat
tcgagtatctttgaaggacatgtaacccgtggcattcctggtgtcgaatggactacagga
aatctgggacagggcttgtcagctggagtgggatttgcattggccgctaaaatgaaggag
caggattaccatatttttgtggcaatgagcgatgcggaacaggcaaaaggacaggtagct
gaagctcgccgggttgcaaaaaaatacgggttgagtaatctgactgttgttatagattac
aatgatgcccagatttctggaagagcaagagacgtaatgccggttaatatcagaaaaaac
tacgaagcagatgggtggagagttctggaagttgatggtcatgatatagaacagcttttg
catgcactttcacaggctgttgaagataaagtcaatcctgttgctatactggcacacact
attatgggcaaaggtgtgtcgttcatggaaaatgatgtttcttatcatgggaaacctctc
gataaagaacaacttgagaaagctctgaatgaacttggcattgataacgatgtggagaaa
tatatgaagatgcgtgctcagcttggtaatcagaaacatgaaccattccatctggagtat
cctgtaaaaataaaagttccagctggcagaacttacacaaccaaaactgataatcggagt
gcttttggaaatgctttattggatttagtaaaagagaacaggaactctgaaacacctgta
gtagctgtagattgcgaccttgcaacatctgtaaagcttgacggggttcagaagtacgtt
ccagaaagatttttagagcttggtgttcaggaacataatgcggcagctgttgcaggagca
ctttctgcagatggtgtggtgaccttttttgctgattttggagtgtttggagtaagtgag
acgtataatcagcacagattgaatgctataaaccacaccaatttgaaagttattgtgact
cattgcggtttaaatgtaggggaggacggaaaaactcaccatggacttgattacatctct
gcacctgcaaattggctgggttacaaagttatcgtaccggcagatcccaatcaaaccgac
agggttattcgctacattgcatcggtatatggaaactacctggtagccatgggcagggca
aaaatgatgcctatcgttgatgaaaatggcaagttgttttttgcggataactatcgtttt
gaatatggaaagatagatattctcagaaaaggaacagatgtgactgttgtgacatgtgga
tctgttgtgccaaatgttgtcgaggctgcggataaattgagaggtaaggtaagcgttctg
aatgtgtcatgcccgcttgatcttgacgagcatgtgttgagagaatatggacacgggaag
aaaatcttggttgttgaggatcatgttgcgacacttggattaacatctcttctggcaaaa
tttttcttgcagaaagggataattccttcaagttttgaacaaattgctattcaagagcat
gcagtttcaggatcttacgaggctctatatgaaatctatggactcagctctactaagatt
gccgaaaagctgggtcagatgatcagttga

DBGET integrated database retrieval system