KEGG   Thermotoga lettingae: Tlet_0136Help
Entry
Tlet_0136         CDS       T00618                                 

Gene name
pyrB
Definition
bifunctional aspartate carbamoyltransferase catalytic subunit/aspartate carbamoyltransferase regulatory subunit
Orthology
K00608  
aspartate carbamoyltransferase [EC:2.1.3.2]
Organism
tle  Thermotoga lettingae
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:tle00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:tle00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(139111..140685)
Genome map
AA seq 524 aa AA seqDB search
MRSFRGRTLALIRDFTIDEQLFLYQKTKELKQKWLNREDMSEFQIKGDVNIYIVFVEPST
RTKESFINAAKFHKNARVNIFDAEHSSFNKNESYVDTFNMLTGYGIYSIFVVRTRLEGVP
RLLERKVGEFAQRHGIERPAFINGGDGKHEHPTQELLDEFTFLEQNNFDNSHIRIALIGD
LLHGRTVHSKVDGLKIFKNVEVDLIAPQQIQMPQHYIEKMKSNGFEVRKFSSIDEYLSNK
DVAKIWYFTRLQLERMGEDILEKEHILRKAVTFRKDMLDKVKEGTKFYHPLPRPKIDPEI
PTFLDELPLNGWEIQARNGFWVRVVLLSLLGGAVEMECDQSITFQKEEDEYEFIIPTQIV
HGTKGVAKEGKRGIKPIENGTVIDHIAKGKSTEEIFNTIVKIRKILKLHDCDSADGIFKS
ADGSYKGYISLPDRYLSKKEIKKLAAIAPNTTVNIIKGASVKEKYRIKLPPKIYNFDEIR
CKNENCITHPKNGENVGASFIRIDDRLVCEYCETPHEYSEIWVI
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgaggagttttcgtggaagaactctcgcgttgatcagggattttactatcgatgagcag
ttatttctctatcagaaaacaaaagaactgaaacagaaatggcttaatagggaggatatg
agtgaatttcagatcaaaggagatgtgaatatttacatcgtttttgtcgaaccgagtacg
agaacaaaagagtcatttataaatgcagcgaaatttcataaaaacgcaagagttaacatc
ttcgatgctgagcattcatccttcaacaagaatgagagctatgtcgatacattcaatatg
ctaacaggttatggaatttattcgatttttgttgtcagaacaaggcttgaaggtgttcca
cgacttctggaaagaaaagtgggtgagtttgcacaaaggcatggtatagagagacctgct
ttcataaatggtggtgatgggaaacatgaacatccaacgcaggaactgttagatgaattc
acttttcttgaacaaaataactttgataattcgcatatcaggattgctctaataggagat
ttattgcacggcagaacagttcattcaaaagtggatggtttgaagattttcaaaaatgtt
gaggtcgatctgattgctccgcagcagattcaaatgccacagcattatatcgaaaaaatg
aaatcaaacggttttgaggtgagaaaattttcatcgatagacgagtatctctcaaataaa
gatgtcgcaaaaatatggtattttacaagattacagcttgagagaatgggagaggatatt
cttgaaaaagagcatatcttgagaaaagctgtaactttcagaaaagatatgctcgacaaa
gtgaaagaggggacaaaattctaccatcctttgcccaggcccaagattgatccagaaata
cccacctttctggatgagctacctctcaatggttgggaaattcaagcaaggaatggtttc
tgggtgagagttgttttgttgtcgctgcttggtggggctgtcgaaatggaatgcgaccag
tcaataacattccagaaagaagaagatgagtatgaattcataatacctacccaaatagtt
catgggacaaaaggtgttgcaaaagaaggaaaacgtggaatcaaacccatcgaaaatgga
actgttatagaccatatagcaaaaggaaagagcaccgaggaaattttcaatacaatagtg
aagatcaggaaaattctaaagcttcatgattgtgatagtgccgatggtatttttaaatct
gccgatggaagttataaaggttacataagtttaccagacagatatctgagcaaaaaagag
atcaaaaaacttgccgcaattgcaccgaatacaactgttaatatcataaaaggcgcttct
gtaaaggaaaaatatagaataaaattacctcctaagatatacaattttgatgaaattaga
tgtaaaaatgaaaactgtataactcatccgaagaatggcgaaaatgttggtgcttcattt
ataagaattgatgacaggttagtctgtgagtactgtgaaacaccacatgaatacagtgaa
atatgggtaatttga

DBGET integrated database retrieval system