KEGG   Thermotoga lettingae: Tlet_0141Help
Entry
Tlet_0141         CDS       T00618                                 

Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
tle  Thermotoga lettingae
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:tle00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:tle00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:tle02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(148874..150196)
Genome map
AA seq 440 aa AA seqDB search
MRKLTVLIMVLVTVMSFAYVKNVILLIGDGMGINHVYLTQLLEGQPLAMTKTPCIGLITT
YSANSWVTDSAAAGTALATGFKTNNRMIGLLPSGENVPTLAEVLKKYGVKIGLVVTCRIT
HATPASFYGHVEDRDMENELAEQLADSDFDVIFGGGYRHFFPESVKGSKRTDDKDLIALM
KGQGYVYVSKKSELETVDEGKVIGLFAPSHLSPASNRPEEQPMLYEMVNKALQLLSRDGE
PFFLMVEGSQIDWEAHDNDVYGVWKETVEFDKAVKVALEFAEKNPDTLVVITADHETGGL
SISSGNQMIEINKLRQYKMNTETFLSRFSIDKKEEFINAARNYYGIDISDEEYRFLLSKK
NSLNSSEFVKEFGRFLSGKSLVGWTTFDHTGMPVPVFSFGPGAENFTGWFDNTEIPRIIA
RLMGYPLTYPIYKEPVTVNN
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgcggaaactgaccgttttgatcatggttctggtaacggttatgagttttgcttatgtg
aaaaacgttattcttttgattggcgacggtatgggtatcaatcacgtttatttaacccaa
ttgctcgaaggccaaccattggctatgacgaaaacaccctgcatcgggttgatcacaact
tactcggcaaattcttgggtgactgattcagcggcagccgggactgccttagcaacaggt
ttcaagacaaacaatagaatgatagggcttttacccagtggcgaaaatgttccaacctta
gcagaagttctcaaaaaatatggagtgaaaataggattagtagttacctgcagaatcacc
catgcaacaccagcctccttttacgggcatgttgaggacagagatatggagaatgaactg
gcagaacaacttgcagatagtgattttgatgttatttttggcggaggttacagacacttc
tttccagaatccgtaaaaggaagcaaaagaactgatgataaagatttaattgcattaatg
aaggggcaggggtatgtttatgtgagcaaaaagtcagaactcgaaactgttgatgaaggg
aaagttataggactttttgctccgagccacctgtctccggcatcaaacagaccagaagag
caacccatgttatacgaaatggtcaataaggcattgcagttgctttcccgggatggtgaa
ccatttttccttatggtagaaggttcacagattgactgggaggcacatgacaatgacgtg
tatggagtttggaaagagactgtggaatttgacaaggcggtaaaggtagctcttgaattt
gcagaaaaaaatcctgacacattggttgtaattactgctgatcacgaaactggcgggctt
tcgatatcatctggaaatcaaatgatcgagatcaataaactcaggcagtacaagatgaac
acagaaacttttttaagcagattttcaatcgacaaaaaagaggagtttatcaatgcagcc
aggaactattacggtatagatatctctgatgaagaatacaggttcttacttagcaaaaag
aatagtttgaattcatctgaatttgttaaagaatttggaagatttttgagtggaaaatct
cttgtaggatggactacctttgaccatactggtatgccagtaccagttttttcatttgga
ccaggagctgaaaacttcacgggatggttcgataatactgaaatcccaagaatcatcgca
agattaatgggatatcctttgacttatccaatatataaagaaccggttactgtgaacaac
taa

DBGET integrated database retrieval system